PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G278600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Trihelix
Protein Properties Length: 310aa    MW: 37107.8 Da    PI: 8.837
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G278600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix79.26.1e-2566148186
            trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                         +W+ qe+++L+ +r e+++++ ++k++k lWe ++ km+e+g +rs++qCk+kw+nl +ryk ++++e +     ++++p++++l+
  Prupe.6G278600.1.p  66 QWSIQETKELLVIRAELDQTFMETKRNKLLWEVIATKMKEKGHHRSAEQCKCKWKNLVTRYKGCETMEPEA---MRQQFPFYNELQ 148
                         7********************************************************************95...56689*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.68E-2165130No hitNo description
PfamPF138373.9E-2066150No hitNo description
PROSITE profilePS500907.50367123IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MEGHHRHHHQ QQQQHHQPLQ HQTHQVHLQQ QQQQQQQQQQ LQQQQLQQPL PSTISVNVDA  60
SDRFPQWSIQ ETKELLVIRA ELDQTFMETK RNKLLWEVIA TKMKEKGHHR SAEQCKCKWK  120
NLVTRYKGCE TMEPEAMRQQ FPFYNELQAI FAARMQRMLW AEESGAASGS KKKALSSDEE  180
EDNEDSEAEN KASTVRKKKK KVKMSNIGIS STSGSGSGNN VREILEEFMK QQMQMEMQWR  240
EEFQARENER RLKEMEWRQT MEALENERIM MERRWREREE QRRMREEARA EKRDALITAL  300
LNKLRREDM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243583.11e-135PREDICTED: trihelix transcription factor GT-3b
SwissprotQ9SDW06e-75TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A0S3RUB81e-119A0A0S3RUB8_PHAAN; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-118(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-54Trihelix family protein