PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G278300.1.p
Common NamePRUPE_ppa023008mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 269aa    MW: 30284.6 Da    PI: 8.7394
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G278300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.8e-322578255
             G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        +rlrWt+eLH+rFveav++LGG+++AtPk il++m+v gLt++h+kSHLQkYR+
  Prupe.6G278300.1.p 25 ERLRWTQELHDRFVEAVTKLGGPDRATPKGILKAMSVSGLTIYHIKSHLQKYRI 78
                        7****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7282181IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.2E-302379IPR009057Homeodomain-like
SuperFamilySSF466893.05E-172478IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-262579IPR006447Myb domain, plants
PfamPF002493.8E-92677IPR001005SANT/Myb domain
PfamPF143792.9E-10110148IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 269 aa     Download sequence    Send to blast
MLGAALIPVE FEMAPSQSDG SAGRERLRWT QELHDRFVEA VTKLGGPDRA TPKGILKAMS  60
VSGLTIYHIK SHLQKYRISK FIPESTSKGK LQKKNISEML PNFGATSGAQ LNEALKIMQI  120
QVQRRLSDQN EVQKILKHKI EAQARFLDIF SAERHNNNKN RPILITKRSK VPLPRTSLPS  180
LCEDSESNAK EFCSDSEAAK TEIQSSAEQF QSLKRLRLHH QNDEVCEIAL NSEWYNQSHS  240
LLLPHEDPIN FPWNLADCSS PLVPTCFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-232381159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G278300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021830335.10.0myb family transcription factor PHL7-like
TrEMBLA0A251NWT90.0A0A251NWT9_PRUPE; Uncharacterized protein
STRINGEMJ097870.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF106592535
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-49G2-like family protein