PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G270000.1.p
Common NamePRUPE_ppa021145mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 93aa    MW: 10646.5 Da    PI: 9.9793
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G270000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.48e-191461148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l+d+++ +G+g+W++ ++  g+ R++k+c++rw +yl
  Prupe.6G270000.1.p 14 KGAWTKEEDQRLIDYIRVHGKGCWRSLPKAAGLLRCGKSCRLRWINYL 61
                        79******************************99************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.222965IPR017930Myb domain
SMARTSM007171.2E-131363IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-211360IPR009057Homeodomain-like
PfamPF002498.4E-171461IPR001005SANT/Myb domain
SuperFamilySSF466893.27E-231587IPR009057Homeodomain-like
CDDcd001671.44E-101661No hitNo description
Gene3DG3DSA:1.10.10.607.7E-106187IPR009057Homeodomain-like
PROSITE profilePS512949.3366692IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MGRSPCCEKV HTNKGAWTKE EDQRLIDYIR VHGKGCWRSL PKAAGLLRCG KSCRLRWINY  60
LRPDLKRGNF TEEEDELIIK LHSLLGKAPL KL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-1713862698MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT1592361e-138KT159236.1 Prunus persica R2R3-MYB transcription factor (MYB20) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208617.14e-59hypothetical protein PRUPE_ppa021145mg, partial
RefseqXP_012075785.15e-57PREDICTED: transcription repressor MYB6
SwissprotP813952e-56MYB30_ANTMA; Myb-related protein 330
TrEMBLA0A067KRC45e-57A0A067KRC4_JATCU; MYB family protein
TrEMBLM5W9115e-59M5W911_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0019s11090.11e-55(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G09460.15e-57myb domain protein 6