PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G257000.4.p
Common NamePRUPE_ppa001883mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 751aa    MW: 84278.9 Da    PI: 6.6603
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G257000.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS379.54.1e-1163777481374
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL++cA+av+++d++ a++lL+++++++sp gd +qRla++++ +L+arla+++s+++kal +++ts    ++ l+a++l+  +sP+ 
  Prupe.6G257000.4.p 377 LRTLLISCAQAVAADDHRSANELLKKVRQHSSPFGDGTQRLAHCLADGLEARLAGTGSQICKALVSKRTS---AADFLKAYHLYLAASPFK 464
                         6789*************************************************************99999...9***************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         k+s+++ N++I++ +++++rvH+iDf+i +G+QWp+L+q ++ R++gpp+lRiTg++ p++g   +e++eetg+rLa +Ae+++vpfe+n+
  Prupe.6G257000.4.p 465 KISNFVSNKTIMNLAQNATRVHVIDFGILYGFQWPTLIQRISWRDGGPPRLRITGIEFPQPGfrPAERVEETGRRLAAYAEKFNVPFEYNA 555
                         *************************************************************9***************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                          +ak++++++leeL+++++E+l+Vn+ ++ ++lldesv+++s+rd+vL+l+++++P+++++   +   n++ F++rf eal ++s+lfd+l
  Prupe.6G257000.4.p 556 -IAKNWDTIKLEELKIDRDEVLVVNFLYRGKNLLDESVAVDSPRDRVLDLIRRINPDLFIHGIVNGAFNAPFFVTRFREALFHFSSLFDML 645
                         .7***************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         e+ +pre++er+ +E e++gre+ nv+aceg er+er et+++W+ r  +aGF ++pl+   +k a   +r  + + + ++e+s +l++gW
  Prupe.6G257000.4.p 646 ETVVPREDRERMLIETEIFGREALNVIACEGWERVERPETYKQWQVRNLRAGFVQLPLDRGLVKRAGEKVRSGYHKDFVIDEDSRWLLQGW 736
                         ************************************************************************99888************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r+++++S W+
  Prupe.6G257000.4.p 737 KGRTVYALSTWK 748
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098566.713351728IPR005202Transcription factor GRAS
PfamPF035141.4E-113377748IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 751 aa     Download sequence    Send to blast
MTMDRRLRAF SDSFNGVQLG NRVLPILSHP NIVARSQFDS NAFLDNNYKE FNYPQPVLTP  60
NNVSSYASVS PEDDSQEDCD FSDVVLKYIN QMLMEEDMED KTCMLQESLE LQAAEKSFYE  120
VLGKKYPPSP ELHQDYAIQY GESPGDSFSG TRSNYITSTC NSGGYFGDNT LIQSPDGHLA  180
QLKGLPAYSI SQSRYGSSTR VSSLDGQVDS PSSLHMPDLN TESQSVWQFK KGVEEASRFL  240
PGETKLVVNL EANGLSAQAP KVGTNGEVVK VEKKDEGEYS PSGSRGRKNL YREDDDVEES  300
RRSKQAAVST ESILRSELFD TVLLCSTGEG LERLESLREA LQNGMSKSMP QNGQSKGSNG  360
GKGRGKKQTG KKEVVDLRTL LISCAQAVAA DDHRSANELL KKVRQHSSPF GDGTQRLAHC  420
LADGLEARLA GTGSQICKAL VSKRTSAADF LKAYHLYLAA SPFKKISNFV SNKTIMNLAQ  480
NATRVHVIDF GILYGFQWPT LIQRISWRDG GPPRLRITGI EFPQPGFRPA ERVEETGRRL  540
AAYAEKFNVP FEYNAIAKNW DTIKLEELKI DRDEVLVVNF LYRGKNLLDE SVAVDSPRDR  600
VLDLIRRINP DLFIHGIVNG AFNAPFFVTR FREALFHFSS LFDMLETVVP REDRERMLIE  660
TEIFGREALN VIACEGWERV ERPETYKQWQ VRNLRAGFVQ LPLDRGLVKR AGEKVRSGYH  720
KDFVIDEDSR WLLQGWKGRT VYALSTWKPA *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443817488375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207215.10.0hypothetical protein PRUPE_ppa001883mg
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM5W3W50.0M5W3W5_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s08690.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein