PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G254900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 496aa    MW: 54172.7 Da    PI: 7.1376
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G254900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like612.4e-19120173155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         k+r +W + L e+F+ a++q+ G  +AtPk+i e+m+ ++Lt ++v+SHLQkYR+
  Prupe.6G254900.1.p 120 KKRCEWKKSLGEKFMLAITQI-GLGNATPKRIIEFMNEPDLTTKNVASHLQKYRI 173
                         689******************.9*******************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.49E-13118176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-19118175IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-18120173IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MASKSVLIVA LLFFVPILCL QGTYAYRIVR DAHRIRRDVS ASASASAPAS VLIVALLFCV  60
PILCLQSIYA YRIGRDASAS ASASASASAS ASASCAIGGF GNGNWDSHGD DEERTAAPRK  120
KRCEWKKSLG EKFMLAITQI GLGNATPKRI IEFMNEPDLT TKNVASHLQK YRIFLKGKEA  180
AAGDEDKLER LSRSSFARGH PELLFNNNER DQPHSQLLNQ PQMKTSIGST FQVQPSAGIG  240
STPPLTAVAS NSHGSIHAPL IRSGQSSLLN NNLANFPRQQ RTLGNRNGDQ LFIQENRPAA  300
FEMQQLSNNF ENGGMSFDPM NNVGLTNNNI GKNNLMQVYP LQSQPGTNNP FSYNLATSVN  360
QNGSNLTPMS SSFHNLWSHF NDVNQCEVDW QSLCSAGFET GASSAYQFPP NLPDNKGDLD  420
PQQNVPVLPP PEGNFNDQCG LLNINVGGGN VENSNRYLHD IYMKPDSLFT DEQDNCQPPS  480
QVHMHQKFMI FFHSC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G254900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020421054.10.0putative two-component response regulator ARR21
TrEMBLA0A251NVT10.0A0A251NVT1_PRUPE; Uncharacterized protein
STRINGXP_008242577.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3991822
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.18e-18response regulator 2