PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G244300.1.p
Common NamePRUPE_ppa005152mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 476aa    MW: 51744.1 Da    PI: 8.8417
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G244300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY104.46.1e-33195251360
                         -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
                WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                         DgynWrKYGqK+vkgse+prsYY+Ct+++Cpvkkkvers  d+++ ei+Y+geHnh+k
  Prupe.6G244300.1.p 195 DGYNWRKYGQKQVKGSEYPRSYYKCTHPNCPVKKKVERSL-DGQIAEIVYKGEHNHSK 251
                         9***************************************.***************85 PP

2WRKY103.61.1e-32395451359
                         -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         Dg++WrKYGqK+vkg+++prsYYrCts +C+v+k+ver ++dpk++++tYeg+Hnh+
  Prupe.6G244300.1.p 395 DGFRWRKYGQKVVKGNPYPRSYYRCTSLKCSVRKHVERVSDDPKAFITTYEGKHNHD 451
                         9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.7E-30182252IPR003657WRKY domain
SuperFamilySSF1182904.05E-26190252IPR003657WRKY domain
SMARTSM007743.8E-37193251IPR003657WRKY domain
PfamPF031061.5E-25195249IPR003657WRKY domain
PROSITE profilePS5081123.686195252IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.3E-34380453IPR003657WRKY domain
SuperFamilySSF1182901.16E-28387453IPR003657WRKY domain
PROSITE profilePS5081134.853388453IPR003657WRKY domain
SMARTSM007743.6E-37393452IPR003657WRKY domain
PfamPF031068.0E-26395451IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009957Biological Processepidermal cell fate specification
GO:0010214Biological Processseed coat development
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 476 aa     Download sequence    Send to blast
MDIKEAERVV IAKPVASRPT CSSFRSFTEL LAGAIDASPS NISSETAVPA IRPKTVRFKP  60
TVNHAVSGLV SSQAEMSGTA HSNSSEKISK SDSRASVVYK PLAKVVSRAT VSALANMGNF  120
NTSHQSTQSS VEAGVLQQNQ DKCFRSQLSP NLRHNNPSCA ETNQTTEPLK IASQNVEEDP  180
KHIPSTANTD RPSYDGYNWR KYGQKQVKGS EYPRSYYKCT HPNCPVKKKV ERSLDGQIAE  240
IVYKGEHNHS KPQPPKKSSS GTQGLGIASD GTGQDTNNRL WNSQLNERNE GSEGRVEDQN  300
EVGLPVHSYQ SKAPLLYDPL ASGGINAGGG TPDNSCGLSG ECEEGSKGPE AEDYEPRSKR  360
RKSENQSNEG GISGEGVPDP RVVVQSSVDS DMTGDGFRWR KYGQKVVKGN PYPRSYYRCT  420
SLKCSVRKHV ERVSDDPKAF ITTYEGKHNH DMPLRNTNPG ASEKDAQAPT TKEKP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A6e-32195453877Probable WRKY transcription factor 4
2lex_A6e-32195453877Probable WRKY transcription factor 4
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Leaf promordia, trichomes, atrichoblasts, fertilized eggs, seed coat.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Regulates trichome development, production of mucilage and tannin in seed coats, and maybe root hair development. {ECO:0000269|PubMed:12084832}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G244300.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by salicylic acid or wounding. {ECO:0000269|PubMed:12084832}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ0201090.0KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205137.10.0WRKY transcription factor 44
RefseqXP_020422895.10.0WRKY transcription factor 44
RefseqXP_020422896.10.0WRKY transcription factor 44
SwissprotQ9ZUU01e-121WRK44_ARATH; WRKY transcription factor 44
TrEMBLM5VZ010.0M5VZ01_PRUPE; Uncharacterized protein
STRINGEMJ063360.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67903450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37260.11e-114WRKY family protein
Publications ? help Back to Top
  1. Kim K,Jiang K,Teng SL,Feldman LJ,Huang H
    Using biologically interrelated experiments to identify pathway genes in Arabidopsis.
    Bioinformatics, 2012. 28(6): p. 815-22
    [PMID:22271267]
  2. Simon M, et al.
    Tissue-specific profiling reveals transcriptome alterations in Arabidopsis mutants lacking morphological phenotypes.
    Plant Cell, 2013. 25(9): p. 3175-85
    [PMID:24014549]
  3. Ranocha P,Francoz E,Burlat V,Dunand C
    Expression of PRX36, PMEI6 and SBT1.7 is controlled by complex transcription factor regulatory networks for proper seed coat mucilage extrusion.
    Plant Signal Behav, 2014. 9(11): p. e977734
    [PMID:25531128]
  4. Verweij W, et al.
    Functionally Similar WRKY Proteins Regulate Vacuolar Acidification in Petunia and Hair Development in Arabidopsis.
    Plant Cell, 2016. 28(3): p. 786-803
    [PMID:26977085]
  5. Gonzalez A, et al.
    TTG2 controls the developmental regulation of seed coat tannins in Arabidopsis by regulating vacuolar transport steps in the proanthocyanidin pathway.
    Dev. Biol., 2016. 419(1): p. 54-63
    [PMID:27046632]
  6. Hassani-Pak K, et al.
    Developing integrated crop knowledge networks to advance candidate gene discovery.
    Appl Transl Genom, 2016. 11: p. 18-26
    [PMID:28018846]