PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G223200.1.p
Common NamePRUPE_ppa005079mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 479aa    MW: 53107.6 Da    PI: 5.5807
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G223200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS301.81.7e-92584752373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalkl..fsevsP 89 
                         ++lL++cA+a++++d++laq++L+ l+++a +dgd++qRl+  f++AL  r ++  + +l +a++ s+++ + +++++++ +l  f +++P
  Prupe.6G223200.1.p  58 EQLLVHCANAIETNDATLAQQILWVLNNIAPQDGDSNQRLTCAFLRALIVRAVNiGSCKLLAAMANSQANFTIHTHKFSVIELasFIDLTP 148
                         79***************************************************95445677777777777666777777777788****** PP

                GRAS  90 ilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp...egppslRiTgvgspesg...skeeleetgerLakfAeelgv 174
                         +++f++ +aN aIleaveg + +Hi+D+++++++Q p+L +a+a R+    +pp l++T+ gs e +      ++ee+g++L +fA++ ++
  Prupe.6G223200.1.p 149 WHRFGFTAANAAILEAVEGYSVIHIVDLSLTHCMQIPTLVDAIAGRQegnVSPPLLKLTVAGSTEDVppmLDLSYEELGSKLVNFARSRNI 239
                         ***********************************************554459**********888798888999**************** PP

                GRAS 175 pfefnvl.......vakrledleleeLrvkp.gEalaVnlvlqlhrll...............................desvsleserde 226
                          +ef+v+        a+ +++l++++L   + gEal+Vn++++lh+++                               +++ +++s r+ 
  Prupe.6G223200.1.p 240 ILEFRVIpssytdgFANLIQQLRVQNLVYAEsGEALVVNCHMMLHYIPeetltlpsinsnpnlsscgssssygydvassSSTSASSSLRTM 330
                         *******8885555555555556666655559********************************************9965555556689** PP

                GRAS 227 vLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWre 317
                         +Lk++++l P+vvv+v+++ad++s++++ r+ +a++y +  +d++++ lpr s++r+++E+  + ++i+nv+a eg++r+er e + +W +
  Prupe.6G223200.1.p 331 FLKALRGLDPTVVVLVDEDADLTSNNLVCRLRSAFNYLWIPYDTVDTFLPRGSKQRQWYEAD-MCWKIENVIAYEGFQRVERVEPKCRWVQ 420
                         **************************************************************.9*************************** PP

                GRAS 318 rleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                         r+++a F++v+++e+a+ ++k++l +++  g+ ++ e++ +vl+Wk++++v+++aW
  Prupe.6G223200.1.p 421 RMRNANFQSVSFGEDAVLEVKAMLDEHA-AGWGLKREEEDVVLTWKGHNVVFATAW 475
                         ****************************.8999*********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.5931457IPR005202Transcription factor GRAS
PfamPF035145.9E-9058475IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MMQFTEAPPP ALHQIITAPF SNLPMMNKNQ THRTRPWPGF PTSAKALGTN FGDANCMEQL  60
LVHCANAIET NDATLAQQIL WVLNNIAPQD GDSNQRLTCA FLRALIVRAV NIGSCKLLAA  120
MANSQANFTI HTHKFSVIEL ASFIDLTPWH RFGFTAANAA ILEAVEGYSV IHIVDLSLTH  180
CMQIPTLVDA IAGRQEGNVS PPLLKLTVAG STEDVPPMLD LSYEELGSKL VNFARSRNII  240
LEFRVIPSSY TDGFANLIQQ LRVQNLVYAE SGEALVVNCH MMLHYIPEET LTLPSINSNP  300
NLSSCGSSSS YGYDVASSSS TSASSSLRTM FLKALRGLDP TVVVLVDEDA DLTSNNLVCR  360
LRSAFNYLWI PYDTVDTFLP RGSKQRQWYE ADMCWKIENV IAYEGFQRVE RVEPKCRWVQ  420
RMRNANFQSV SFGEDAVLEV KAMLDEHAAG WGLKREEEDV VLTWKGHNVV FATAWMPA*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205132.10.0hypothetical protein PRUPE_ppa005079mg
SwissprotQ9SN220.0SCL32_ARATH; Scarecrow-like protein 32
TrEMBLM5VYZ60.0M5VYZ6_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00340.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.10.0GRAS family protein