PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G223100.1.p
Common NamePRUPE_ppa010480mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 249aa    MW: 26876.2 Da    PI: 9.7175
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G223100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260621.6e-1924982397
              DUF260 23 paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                        p + ++++ +v+k+FG++ ++++++a+p+++r+ +++sl++eA+ r+ +Pv+Gavg++++++++++q+++e++l+
  Prupe.6G223100.1.p 24 PRSPSHATVFVAKFFGRAGLMSFISAVPDSQRPVLFQSLLFEACGRTVNPVNGAVGLLWTGNWHVCQAAVETVLR 98
                        45556999*************************************************************998876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.9421102IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-152696IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MPSSPKGLQR ILHAPPLPPV DRNPRSPSHA TVFVAKFFGR AGLMSFISAV PDSQRPVLFQ  60
SLLFEACGRT VNPVNGAVGL LWTGNWHVCQ AAVETVLRGG TLRPIPELLG GGSTSDEASD  120
ADGGGVNNCT DMWRLRDPSH NSGSSSRFTS SRSARVSSPK RKRSADEESS TKVLQLQHHA  180
DLDLRLTPSP TFKAKPKPET RRAGTPSMNS EESVVTTCFE SGLPDNHHQY NQHSYGVGAE  240
RKLLNLFP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.143891e-98fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205779.10.0hypothetical protein PRUPE_ppa010480mg
SwissprotQ9SN236e-65LBD38_ARATH; LOB domain-containing protein 38
TrEMBLM5WCH60.0M5WCH6_PRUPE; Uncharacterized protein
STRINGPOPTR_0007s10010.14e-75(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72134136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.12e-59LOB domain-containing protein 38