PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G220800.1.p
Common NamePRUPE_ppa004454mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 510aa    MW: 57075.9 Da    PI: 5.4603
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G220800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS355.39.4e-1091285083374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkf 93 
                         elLle A+a+++++ +++q+l++ l+el sp+gd+ q+l++yf++AL +r+++s++++y++l + ++++ + +++ +++  f+evsP+ +f
  Prupe.6G220800.1.p 128 ELLLETAKAIADKNSSRVQQLMWMLNELGSPYGDTDQKLTSYFLQALFSRMTDSGDRCYRTLISASEKTCSFESTRKMVLKFQEVSPWTTF 218
                         69***********************************************************96655554444444444455********** PP

                GRAS  94 shltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.......skeeleetgerLakfAeelgvpfe 177
                         +h+++N aI+ea++ge ++HiiD++ ++++QWp+Ll+aLa+R++++p+lR+T+v++ +++        ++ ++e+g r++kfA+ +gvpf+
  Prupe.6G220800.1.p 219 GHVACNGAIMEAFDGEPKLHIIDISNTYCTQWPTLLEALATRTDETPHLRLTTVVATRASdgsggapAQKVMKEIGARMEKFARLMGVPFK 309
                         ******************************************************9987778999**999********************** PP

                GRAS 178 fnvlvak.rledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnse....sFlerflealey 263
                         fn+++++ +l++l+l+eL+++ +EalaVn+v  lh++     ++ ++rd ++++++sl+P+++++ve+ead++ +    +F+++f e+l++
  Prupe.6G220800.1.p 310 FNAVHHSgDLSELNLSELDIRDDEALAVNCVGTLHSIQ----AVGNRRDYLVSAFRSLRPRIITLVEEEADLDVGvdglDFVHGFQECLRW 396
                         ****8888*****************************8....8888899********************8885444555************ PP

                GRAS 264 ysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.. 352
                         + + f++l+++++r+s+er ++Er+  gr++v++vac+ +e++er+et+ +W++r++ aGF+pv++s+++ +++++llr++k +g+ +   
  Prupe.6G220800.1.p 397 FRVYFEALDESFARTSNERLMLERA-AGRAVVDLVACAPSESVERRETATRWSRRMHGAGFSPVTFSDEVCDDVRALLRRYK-EGWAMTqc 485
                         *************************.********************************************************.55444433 PP

                GRAS 353 .eesgslvlgWkdrpLvsvSaWr 374
                          e  + ++l Wkd+p+v++SaWr
  Prupe.6G220800.1.p 486 sEAGAGIFLSWKDQPVVWASAWR 508
                         25566677**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.998100486IPR005202Transcription factor GRAS
PfamPF035143.2E-106128508IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008356Biological Processasymmetric cell division
GO:0009956Biological Processradial pattern formation
GO:0045930Biological Processnegative regulation of mitotic cell cycle
GO:0048366Biological Processleaf development
GO:0055072Biological Processiron ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MDTLFKLVSL QSDHHQSFNN STTTRTSTPT TTTTTSSSSR SSFLSPSHQN LHPNYPHQND  60
DVEECFNFFM DEEDFSSSSS KHYYPSNHPT PPTPNPLLTT TTTPTPTDFS FSPALINFEL  120
SNGKWAPELL LETAKAIADK NSSRVQQLMW MLNELGSPYG DTDQKLTSYF LQALFSRMTD  180
SGDRCYRTLI SASEKTCSFE STRKMVLKFQ EVSPWTTFGH VACNGAIMEA FDGEPKLHII  240
DISNTYCTQW PTLLEALATR TDETPHLRLT TVVATRASDG SGGAPAQKVM KEIGARMEKF  300
ARLMGVPFKF NAVHHSGDLS ELNLSELDIR DDEALAVNCV GTLHSIQAVG NRRDYLVSAF  360
RSLRPRIITL VEEEADLDVG VDGLDFVHGF QECLRWFRVY FEALDESFAR TSNERLMLER  420
AAGRAVVDLV ACAPSESVER RETATRWSRR MHGAGFSPVT FSDEVCDDVR ALLRRYKEGW  480
AMTQCSEAGA GIFLSWKDQP VVWASAWRP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3416050837375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205058.10.0hypothetical protein PRUPE_ppa004454mg
SwissprotQ9SZF70.0SHR_ARATH; Protein SHORT-ROOT
TrEMBLM5VXS80.0M5VXS8_PRUPE; Uncharacterized protein
STRINGVIT_07s0129g00030.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF129734106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37650.10.0GRAS family protein