PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G177200.3.p
Common NamePRUPE_ppa007578mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 363aa    MW: 40858.2 Da    PI: 6.8924
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G177200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.91.6e-1175112239
                         XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLe 39 
                         + +k++rr+++NReAAr+sR RKka++++Le+   +L 
  Prupe.6G177200.3.p  75 PTDKVQRRLAQNREAARKSRMRKKAYVQQLETSRLKLI 112
                         579****************************8655554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-870121No hitNo description
SMARTSM003382.0E-774134IPR004827Basic-leucine zipper domain
PfamPF001702.2E-876107IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.95676118IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.53E-778113No hitNo description
CDDcd147081.82E-2178130No hitNo description
PROSITE patternPS0003608196IPR004827Basic-leucine zipper domain
PfamPF141443.5E-29164239IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0042742Biological Processdefense response to bacterium
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNSPSTQFVT SRRMGAYEPI HQISMWEESF KSNGNFNASA SMIVDADTKL DNQSEDASHG  60
ILGPSSKYDQ EATKPTDKVQ RRLAQNREAA RKSRMRKKAY VQQLETSRLK LIQLEQELDR  120
ARQQGIYIGS GLDASPLGFS GTINSGVTTF EMEYGHWVEE QNRQINELRT ALHAHISDIE  180
LRFLVDSGMS HYFELFSMKL TAAKADVFYV MSGMWKTSAE RFFSWIGGFR PSEILKVLQP  240
HLDPLTDQQV LDVYNLRQSC QQAEDALSQG MDKLQLTLAD TVAAGQLGEG SYVPQMANAM  300
QKLEELVSFV QQADNLRRGT LQQMSCILTI RQAARGLLAL GEYFQRLRAL SSLWATRPRE  360
PA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Predominantly expressed in roots. {ECO:0000269|PubMed:8628224}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00586DAPTransfer from AT5G65210Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G177200.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008234522.10.0PREDICTED: transcription factor TGA1 isoform X2
RefseqXP_020421616.10.0transcription factor TGA1 isoform X2
RefseqXP_020421617.10.0transcription factor TGA1 isoform X2
SwissprotQ392370.0TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A251NS130.0A0A251NS13_PRUPE; Uncharacterized protein
STRINGXP_008234510.10.0(Prunus mume)
STRINGEMJ066050.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.50.0bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]