PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G169700.1.p
Common NamePRUPE_ppa015480mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WRKY
Protein Properties Length: 197aa    MW: 22175.3 Da    PI: 6.6649
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G169700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY95.34.2e-30106164159
                         ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                         +dDg++WrKYG+K+vk+s++pr+YY+C+s gC+vkk+ver++ed ++v++tY g Hnhe
  Prupe.6G169700.1.p 106 MDDGFKWRKYGKKSVKNSPNPRNYYKCSSGGCNVKKRVERDREDSSYVITTYDGVHNHE 164
                         59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.804.0E-3293166IPR003657WRKY domain
SuperFamilySSF1182903.79E-2799166IPR003657WRKY domain
PROSITE profilePS5081130.825101166IPR003657WRKY domain
SMARTSM007749.2E-34106165IPR003657WRKY domain
PfamPF031062.2E-23107164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MDCLQNPNPS SAGPYHFGES IDPSMDFDEF SDYFMLDYDV DDHQDSSSLS TVSPEKFMAD  60
RSTGSSGGAT SRNSNNNMKC RNEGRRNKIE MGHRVAFRTK SELEVMDDGF KWRKYGKKSV  120
KNSPNPRNYY KCSSGGCNVK KRVERDREDS SYVITTYDGV HNHESPCVVY YNQMPPPVDP  180
NNIWTLRASS QSSASS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-2494166274WRKY transcription factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G169700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206237.11e-145probable WRKY transcription factor 51
SwissprotQ93WU92e-52WRK51_ARATH; Probable WRKY transcription factor 51
TrEMBLM5W2471e-144M5W247_PRUPE; Uncharacterized protein
STRINGEMJ074361e-145(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF112034110
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64810.12e-50WRKY DNA-binding protein 51
Publications ? help Back to Top
  1. Yan C, et al.
    Injury Activates Ca2+/Calmodulin-Dependent Phosphorylation of JAV1-JAZ8-WRKY51 Complex for Jasmonate Biosynthesis.
    Mol. Cell, 2018. 70(1): p. 136-149.e7
    [PMID:29625034]