PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G156000.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 278aa    MW: 31093.8 Da    PI: 8.2315
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G156000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1439.6e-14200247553
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 
                         +r rrk+kNRe+A rsR+RK+a+  eL  kv  Le+eN +Lkke +e +
  Prupe.6G156000.1.p 200 RRLRRKIKNRESAARSRARKQAYHNELVSKVSRLEEENIKLKKE-KEFE 247
                         689***************************************87.4455 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.2E-9196268IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.841198243IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.31E-10200246No hitNo description
CDDcd147073.92E-14200237No hitNo description
PfamPF001708.1E-12200244IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.4E-13200245No hitNo description
PROSITE patternPS000360203218IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGFQTMASQG NGQQSHFQPS PLLRQPSWYS LTLDEVKNQL GDTGKPLGSM NLDELLQNLW  60
TAEANQSIEM DIENTSSASS LQRQASLTLA RALSGKTVDE VWREIQQGQK KRYGEDMKCQ  120
DTEITLGETT LEDFLVQAGL FAEASLSPAI ALDTIEVAIP QSYPHNLGLS SSPSFGTHSD  180
TTTPGRKRDA SDAYEKTVER RLRRKIKNRE SAARSRARKQ AYHNELVSKV SRLEEENIKL  240
KKEKEFEKML PSALSAEPKY QLRRISSHHQ MAGRSCH*
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed in embryo during the latest stages of seed maturation. {ECO:0000269|PubMed:15642716}.
UniprotTISSUE SPECIFICITY: Predominantly expressed in seeds. {ECO:0000269|PubMed:12376636}.
Functional Description ? help Back to Top
Source Description
UniProtBinds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G156000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2230150.0KT223015.1 Prunus persica bZIP protein 5 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020422570.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 2 isoform X1
SwissprotQ9LES34e-69AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A251NR560.0A0A251NR56_PRUPE; Uncharacterized protein
STRINGXP_008231203.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF124642532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.13e-54ABA-responsive element binding protein 3
Publications ? help Back to Top
  1. Zhou H, et al.
    Peach MYB7 activates transcription of the proanthocyanidin pathway gene encoding leucoanthocyanidin reductase, but not anthocyanidin reductase.
    Front Plant Sci, 2015. 6: p. 908
    [PMID:26579158]
  2. Kim H, et al.
    ABA-HYPERSENSITIVE BTB/POZ PROTEIN 1 functions as a negative regulator in ABA-mediated inhibition of germination in Arabidopsis.
    Plant Mol. Biol., 2016. 90(3): p. 303-15
    [PMID:26667153]
  3. Song C,Kim T,Chung WS,Lim CO
    The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
    Mol. Cells, 2017. 40(8): p. 577-586
    [PMID:28756655]