PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G138100.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 328aa    MW: 36804.9 Da    PI: 7.1424
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G138100.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM92.66.4e-2988253128
                 NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Prupe.6G138100.3.p   8 QSDNEWFFFSPRGRKYPNGSQSRRATEFGYWKATGKERNVKS-TSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 82 
                         5689**************************************.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100536.377198IPR003441NAC domain
SuperFamilySSF1019411.03E-32797IPR003441NAC domain
PfamPF023651.3E-131181IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MNAKSVIQSD NEWFFFSPRG RKYPNGSQSR RATEFGYWKA TGKERNVKST SNVIGTKRTL  60
VFHMGRAPKG ERTEWIMHEY CMNDKSQDSI VVCRLRKNSD FRLNDTTNGG SSSRNPLSTV  120
HNSENAVSEV GIIDYDKPVE CYSKKSTSSH DSHSTEQIDS ASESNQKQTT EVTQTESSGH  180
QKGSYDDDFY ADILNDDIIK LDEVSVSASA DTLPVLANKS EAEQNSHQPM QAICNSEAIP  240
FQGTANRRIH LRKRKEKFPA ESLDGPNSHE SPKTSADRMD DQHVLLYVII IILVLLALFL  300
SKFCFTDIAG SVSFLVERFL PSQKHHK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-2599769164NO APICAL MERISTEM PROTEIN
1ut4_B1e-2599769164NO APICAL MERISTEM PROTEIN
1ut7_A1e-2599769164NO APICAL MERISTEM PROTEIN
1ut7_B1e-2599769164NO APICAL MERISTEM PROTEIN
4dul_A1e-2599769164NAC domain-containing protein 19
4dul_B1e-2599769164NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1251256RKRKEK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G138100.3.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020421679.10.0NAC domain-containing protein 40
TrEMBLA0A251NQ210.0A0A251NQ21_PRUPE; Uncharacterized protein
STRINGXP_008229937.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44290.12e-62NAC domain containing protein 60