PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G138100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 391aa    MW: 43747.8 Da    PI: 6.2441
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G138100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.46.9e-50171451128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         + pGfrF+Ptdeel+++yLk+k+eg +  +  evi+evdi+++ePwdLp k+v ++++ew+fFs+r +ky++g++++rat+ gyWkatgk+
  Prupe.6G138100.1.p  17 MFPGFRFSPTDEELISYYLKNKLEGPEpGKSVEVIPEVDICNFEPWDLPaKSVIQSDNEWFFFSPRGRKYPNGSQSRRATEFGYWKATGKE 107
                         579**********************996444589***************667777899********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++v+s +++++g+k+tLvf+ grapkge+t+W+mhey +
  Prupe.6G138100.1.p 108 RNVKS-TSNVIGTKRTLVFHMGRAPKGERTEWIMHEYCM 145
                         *****.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-557160IPR003441NAC domain
PROSITE profilePS5100554.50717161IPR003441NAC domain
PfamPF023651.0E-2519144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
MGAVSKEAQL SIAASSMFPG FRFSPTDEEL ISYYLKNKLE GPEPGKSVEV IPEVDICNFE  60
PWDLPAKSVI QSDNEWFFFS PRGRKYPNGS QSRRATEFGY WKATGKERNV KSTSNVIGTK  120
RTLVFHMGRA PKGERTEWIM HEYCMNDKSQ DSIVVCRLRK NSDFRLNDTT NGGSSSRNPL  180
STVHNSENAV SEVGIIDYDK PVECYSKKST SSHDSHSTEQ IDSASESNQK QTTEVTQTES  240
SGHQKGSYDD DFYADILNDD IIKLDEVSVS ASADTLPVLA NKSEAEQNSH QPMQAICNSE  300
AIPFQGTANR RIHLRKRKEK FPAESLDGPN SHESPKTSAD RMDDQHVLLY VIIIILVLLA  360
LFLSKFCFTD IAGSVSFLVE RFLPSQKHHK *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-421616016164NO APICAL MERISTEM PROTEIN
1ut4_B8e-421616016164NO APICAL MERISTEM PROTEIN
1ut7_A8e-421616016164NO APICAL MERISTEM PROTEIN
1ut7_B8e-421616016164NO APICAL MERISTEM PROTEIN
3swm_A8e-421616119168NAC domain-containing protein 19
3swm_B8e-421616119168NAC domain-containing protein 19
3swm_C8e-421616119168NAC domain-containing protein 19
3swm_D8e-421616119168NAC domain-containing protein 19
3swp_A8e-421616119168NAC domain-containing protein 19
3swp_B8e-421616119168NAC domain-containing protein 19
3swp_C8e-421616119168NAC domain-containing protein 19
3swp_D8e-421616119168NAC domain-containing protein 19
4dul_A8e-421616016164NAC domain-containing protein 19
4dul_B8e-421616016164NAC domain-containing protein 19
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1314319RKRKEK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G138100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020421679.10.0NAC domain-containing protein 40
TrEMBLA0A251NQ150.0A0A251NQ15_PRUPE; Uncharacterized protein
STRINGXP_008229937.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.11e-91NTM1-like 8