PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G134400.1.p
Common NamePRUPE_ppa010337mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 254aa    MW: 28999.5 Da    PI: 5.5214
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G134400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.61.9e-4741351128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                         lppG+rF Pt+eelv++yL +k+egk+ ++ +vi+ vdiy+ ePwdLpk     +++++++w+fF++r++++a+g r+nr+t+sgyWkatg
  Prupe.6G134400.1.p   4 LPPGYRFYPTEEELVSFYLLNKLEGKRDDTRRVIPVVDIYSKEPWDLPKfsgeLCHGDTEQWFFFTPRQQREAQGGRPNRTTASGYWKATG 94 
                         79****************************99****************656754445777******************************* PP

                 NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +   v+s++++++g+kkt+vfykg+ap+g+kt+W m+eyr+
  Prupe.6G134400.1.p  95 SPGYVYSSDNKVIGVKKTMVFYKGKAPTGRKTKWKMNEYRA 135
                         ***************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-513163IPR003441NAC domain
PROSITE profilePS5100550.2944164IPR003441NAC domain
PfamPF023657.8E-255134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MEELPPGYRF YPTEEELVSF YLLNKLEGKR DDTRRVIPVV DIYSKEPWDL PKFSGELCHG  60
DTEQWFFFTP RQQREAQGGR PNRTTASGYW KATGSPGYVY SSDNKVIGVK KTMVFYKGKA  120
PTGRKTKWKM NEYRAIEADN PTTTSTSVPK YLRNEFRLCR VYVVSGSCRA FDRRPLEGSG  180
ETKHQLSESM GGTSTFSLKA PMVEKASSSD ETFSYSEELA DLPETYAGIN STNWEIIEGL  240
EQPLWEWEQL NLL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-37416217163NO APICAL MERISTEM PROTEIN
1ut4_B7e-37416217163NO APICAL MERISTEM PROTEIN
1ut7_A7e-37416217163NO APICAL MERISTEM PROTEIN
1ut7_B7e-37416217163NO APICAL MERISTEM PROTEIN
3swm_A8e-37416220166NAC domain-containing protein 19
3swm_B8e-37416220166NAC domain-containing protein 19
3swm_C8e-37416220166NAC domain-containing protein 19
3swm_D8e-37416220166NAC domain-containing protein 19
3swp_A8e-37416220166NAC domain-containing protein 19
3swp_B8e-37416220166NAC domain-containing protein 19
3swp_C8e-37416220166NAC domain-containing protein 19
3swp_D8e-37416220166NAC domain-containing protein 19
4dul_A7e-37416217163NAC domain-containing protein 19
4dul_B7e-37416217163NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G134400.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0517662e-43BT051766.1 Medicago truncatula clone MTYF5_F6_F7_F81G-H-6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207479.10.0NAC domain-containing protein 90
SwissprotQ9FMR33e-90NAC90_ARATH; NAC domain-containing protein 90
TrEMBLM5WHE70.0M5WHE7_PRUPE; Uncharacterized protein
STRINGEMJ086780.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF87134123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G22380.11e-92NAC domain containing protein 90
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]