PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G128900.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 385aa    MW: 42863.7 Da    PI: 5.1305
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G128900.4.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.63e-14302354557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+++ e +++ +
  Prupe.6G128900.4.p 302 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTKLKQNVAESEQKRK 354
                         69****************************************99999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-12298362IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.231300352IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-11302351No hitNo description
CDDcd147078.31E-24302364No hitNo description
PfamPF001709.3E-12302355IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.1E-14302355No hitNo description
PROSITE patternPS000360305320IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MVASDESGSI GYDNDNFEFE FEPEQPLEPQ EESSQDDSHH SMGNNTKQNS IFSLTLDEIQ  60
CKSGRNFGSM NMDEFLANIW SVEEENQTQQ QPSQCDQDAS DKDTTINPST LSRQGSFSIP  120
IPLCKKTVDE VWSEIERSRP QHHDPDNNIS DSVPPQRQQT IGEITLEDFL VKAGVVQESP  180
SKSKPPPLKK MESTLIQQQC GDTNMGNEIS ICLDASFGIG RQLFGSGFFN LQNDVPSNLS  240
GNGYAIGATY PMLGRQSKVI VGEPSCVSAI EKCHSLPESS SGGGAKNKKR IIDGPPEVVV  300
ERRQRRMIKN RESAARSRAR KQAYTVELEA ELNQLKEENT KLKQNVAESE QKRKQELLGK  360
KQPTRAQKLA EKLRTMRRAV SLAW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G128900.4.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420936.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform X1
TrEMBLA0A251NPI70.0A0A251NPI7_PRUPE; Uncharacterized protein
STRINGXP_008228533.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.12e-68bZIP family protein