PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G128900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 429aa    MW: 47969.8 Da    PI: 5.7009
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G128900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.43.6e-14346398557
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                         +r+rr++kNRe+A rsR+RK+a++ eLe +  +L++eN++Lk+++ e +++ +
  Prupe.6G128900.1.p 346 RRQRRMIKNRESAARSRARKQAYTVELEAELNQLKEENTKLKQNVAESEQKRK 398
                         69****************************************99999888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.6E-12342406IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.231344396IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.4E-14345397No hitNo description
PfamPF001701.1E-11346399IPR004827Basic-leucine zipper domain
CDDcd147076.73E-24346408No hitNo description
SuperFamilySSF579597.5E-11346395No hitNo description
PROSITE patternPS000360349364IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0033613Molecular Functionactivating transcription factor binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MLFIGCSLLH FLLPSSIEAY NQPHLRGLII EHLFLQQHSP FYAKMVASDE SGSIGYDNDN  60
FEFEFEPEQP LEPQEESSQD DSHHSMGNNT KQNSIFSLTL DEIQCKSGRN FGSMNMDEFL  120
ANIWSVEEEN QTQQQPSQCD QDASDKDTTI NPSTLSRQGS FSIPIPLCKK TVDEVWSEIE  180
RSRPQHHDPD NNISDSVPPQ RQQTIGEITL EDFLVKAGVV QESPSKSKPP PLKKMESTLI  240
QQQCGDTNMG NEISICLDAS FGIGRQLFGS GFFNLQNDVP SNLSGNGYAI GATYPMLGRQ  300
SKVIVGEPSC VSAIEKCHSL PESSSGGGAK NKKRIIDGPP EVVVERRQRR MIKNRESAAR  360
SRARKQAYTV ELEAELNQLK EENTKLKQNV AESEQKRKQE LLGKKQPTRA QKLAEKLRTM  420
RRAVSLAW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G128900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420936.10.0ABSCISIC ACID-INSENSITIVE 5-like protein 1 isoform X1
TrEMBLA0A251NPJ30.0A0A251NPJ3_PRUPE; Uncharacterized protein
STRINGXP_008228533.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20923374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44460.18e-68bZIP family protein