PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G098600.1.p
Common NamePRUPE_ppa017586mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 349aa    MW: 39831.7 Da    PI: 8.2781
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G098600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1592e-49151421128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGf+FhP+deel+v+yL++kv +++l++ + i+e+++yk++Pw+Lp+++  +e+ewyfFs+rd+ky++g r+nra++sgyWka  +dk+
  Prupe.6G098600.1.p  15 LPPGFKFHPSDEELIVHYLRNKVISHPLPA-QLITEINLYKYNPWELPNNAFFGEDEWYFFSPRDRKYPNGVRPNRAAASGYWKAASSDKP 104
                         79****************************.89***************77667899*********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +l++ +++ +g+kk Lvfy+grapkg+kt+W+m+eyrl
  Prupe.6G098600.1.p 105 ILTSrGSKRIGVKKALVFYTGRAPKGVKTEWIMNEYRL 142
                         *99867788***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.07E-6011168IPR003441NAC domain
PROSITE profilePS5100558.52215169IPR003441NAC domain
PfamPF023656.6E-2616142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MEKESTFPSS ALQLLPPGFK FHPSDEELIV HYLRNKVISH PLPAQLITEI NLYKYNPWEL  60
PNNAFFGEDE WYFFSPRDRK YPNGVRPNRA AASGYWKAAS SDKPILTSRG SKRIGVKKAL  120
VFYTGRAPKG VKTEWIMNEY RLLDDTVKPS RLKGSMRLDD WVLCRVQHRG NRSKNACNSQ  180
DSYSTEFWRY PPKVEQTQPT YANLHADIIT DFPYKDCQLL ASILSSQAPS PTETNSSVSF  240
QGSKDSYEVR SNNMVKSTIS ISSSGIDSNT LKMKTTEENM KENHFPLINN RESKKIDENL  300
PPSMRPAGNA INCYIPNHSQ YDLLNAHPTD PTNFEEFNEM TFPGTYFE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-6811664162NO APICAL MERISTEM PROTEIN
1ut4_B1e-6811664162NO APICAL MERISTEM PROTEIN
1ut7_A1e-6811664162NO APICAL MERISTEM PROTEIN
1ut7_B1e-6811664162NO APICAL MERISTEM PROTEIN
3swm_A2e-6811667165NAC domain-containing protein 19
3swm_B2e-6811667165NAC domain-containing protein 19
3swm_C2e-6811667165NAC domain-containing protein 19
3swm_D2e-6811667165NAC domain-containing protein 19
3swp_A2e-6811667165NAC domain-containing protein 19
3swp_B2e-6811667165NAC domain-containing protein 19
3swp_C2e-6811667165NAC domain-containing protein 19
3swp_D2e-6811667165NAC domain-containing protein 19
4dul_A1e-6811664162NAC domain-containing protein 19
4dul_B1e-6811664162NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G098600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207937.10.0NAC domain-containing protein 2
TrEMBLM5W7330.0M5W733_PRUPE; Uncharacterized protein
STRINGEMJ091360.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-75NAC-like, activated by AP3/PI