PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G098300.1.p
Common NamePRUPE_ppa017531mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 247aa    MW: 28556.3 Da    PI: 8.7688
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G098300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.91.4e-17101404128
                 NAM   4 GfrFhPtdeelvveyLkkkvegkk...leleevikevdiykv.ePwdLpk...kvkaeekewyfFskrdkkyatgkrknr.atksgyWkat 86 
                          f+FhPtd+e++   L k v +++    + + ++++ d++ + ePw++ +   + + +++++yf ++ ++ +  ++r++r +  +g+W++ 
  Prupe.6G098300.1.p  10 AFHFHPTDQEIIRSILYKMVIEREplnPSYHGIVHDEDLFGTkEPWKIWEdygRDQLHDQDLYFICQLKRINYCSSRTHRrIGCEGTWSQR 100
                         69*****************988887765556679999*998779****74334434477899******9999999999885667******* PP

                 NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            k +++ + + +g  + L + +   ++ ++++W+++ey+l
  Prupe.6G098300.1.p 101 VAPKLIYDGNPNPIGNVRKLRYKN--PKSEHNAEWFLDEYSL 140
                         ********9999**********84..444469********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-194163IPR003441NAC domain
PROSITE profilePS5100521.9557164IPR003441NAC domain
PfamPF023653.7E-1110140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 247 aa     Download sequence    Send to blast
MANSRNVSLA FHFHPTDQEI IRSILYKMVI EREPLNPSYH GIVHDEDLFG TKEPWKIWED  60
YGRDQLHDQD LYFICQLKRI NYCSSRTHRR IGCEGTWSQR VAPKLIYDGN PNPIGNVRKL  120
RYKNPKSEHN AEWFLDEYSL FVGDEGHDQT TPGFDFVVCR LRKNHNKING YFLLAARSHN  180
GNQGLTIMLI HRDSPESPTP LPTQPHTSTN NSKTQFSSYP KLACRPSTSN PKLILLSIMF  240
NNRILC*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G098300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020421234.11e-125NAC domain-containing protein 68
TrEMBLM5W5X70.0M5W5X7_PRUPE; Uncharacterized protein
STRINGEMJ087460.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12591634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.12e-10Arabidopsis NAC domain containing protein 87