PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G093900.1.p
Common NamePRUPE_ppa011528mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 215aa    MW: 23223.3 Da    PI: 5.6023
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G093900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.35.6e-43491481100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+++l+
  Prupe.6G093900.1.p  49 PCAACKILRRRCAEKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEASARIRDPVYGCAGAICHLQKQVNELQ 139
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         a+la++++e
  Prupe.6G093900.1.p 140 AQLAKAQAE 148
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.31348149IPR004883Lateral organ boundaries, LOB
PfamPF031954.2E-4349146IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MECSNETMNT NYTTTSSTPL SQSPSSSPSS PPPPLPPTPT PNPPVVISPC AACKILRRRC  60
AEKCVLAPYF PPTEPAKFTI AHRVFGASNI IKFLQELPES QRADAVSSMV YEASARIRDP  120
VYGCAGAICH LQKQVNELQA QLAKAQAELV NMQCQQANLV ALICMEMTQS NDQGSPQQSL  180
DHNFITSSHG SNQGNISFLD DTTTLGSLWE PLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205910.11e-153hypothetical protein PRUPE_ppa011528mg
SwissprotQ9LQR01e-79LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5W0701e-153M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.22e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-70LOB domain-containing protein 1