PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G092100.1.p
Common NamePRUPE_ppb020756mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 377aa    MW: 43599.4 Da    PI: 4.4683
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G092100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM57.93.5e-1851373128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkk.....leleevikevdi..ykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratk.sgy 82 
                          GfrF+Ptd+e++ ++L k v +++      + ++vi ++++  +k eP+++ + + +   +++++yf s+ ++   +g r++r+t   g+
  Prupe.6G092100.1.p   5 LGFRFDPTDQEIIGFFLYKVVVANNpltlmPPYNKVIYKCNLfgNKREPSEIWRDYGGdqlDDQDLYFVSELQR---NGLRTQRKTGsCGT 92 
                         6******************98888778886666678****9833577*****7533322236667888888766...6899999776479* PP

                 NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         W++t + ++v+++ +e +g k+ + + +g++++  ++ W+++ey+l
  Prupe.6G092100.1.p  93 WSETETYQDVKDEVDEIIGRKRKFRYENGNTSE-DHAGWLLDEYSL 137
                         *************99***********9998888.89********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100523.9723163IPR003441NAC domain
SuperFamilySSF1019417.45E-204163IPR003441NAC domain
PfamPF023651.1E-136137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MTQLLGFRFD PTDQEIIGFF LYKVVVANNP LTLMPPYNKV IYKCNLFGNK REPSEIWRDY  60
GGDQLDDQDL YFVSELQRNG LRTQRKTGSC GTWSETETYQ DVKDEVDEII GRKRKFRYEN  120
GNTSEDHAGW LLDEYSLFEK GCKNRTSRNC YDFDVVICRL RRKCNMNKSG KKRKCSSRDQ  180
SNKKMKRDQS TKETKTENSV GPQIMNDESN QLMINDITTC DQDYLIDTNH KSFNIDELFV  240
ELDREPPLLH SQQLPQIVES QEKPLPTSCL CVNQFDGALE AAASNLSNFE YNSELARSTW  300
QHNMNADDHQ DPNLIFTVDE LLAEDAEPLS TYALDDVYNV VSQPLDQNSC WSKSFMDQTY  360
NSYIYSSIEE EIIADN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160185RRKCNMNKSGKKRKCSSRDQSNKKMK
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G092100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206987.10.0protein BEARSKIN2
TrEMBLM5W4C60.0M5W4C6_PRUPE; Uncharacterized protein
STRINGEMJ081860.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1785336
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24430.23e-08NAC domain containing protein 38