PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G085000.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 196aa    MW: 22053.4 Da    PI: 4.8754
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G085000.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-16243548
                        -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        T++E+ l ++++ ++G++ W++Iar+++ gRt++++k++w++++
  Prupe.6G085000.3.p  2 TPQEERLVLELHSKWGNR-WSRIARKLP-GRTDNEIKNYWRTHM 43
                        9*****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.292147IPR017930Myb domain
CDDcd001678.19E-12143No hitNo description
SMARTSM007171.1E-11145IPR001005SANT/Myb domain
PfamPF002491.6E-14242IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-20244IPR009057Homeodomain-like
SuperFamilySSF466892.18E-12247IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MTPQEERLVL ELHSKWGNRW SRIARKLPGR TDNEIKNYWR THMRKKAQEK KRAASPSSSS  60
SNCSSSSNIT STEGGASFYD TGGLEIKASS GAKKTGGDHQ EQEDDKKRDQ KEYSLDDIWK  120
DINLPEVNSI EPVYNGYSEE ACNIISCPLM ASPAPWEYCS DSLWEMDEEE SKMFLPTTSD  180
QFLSCFEYGK ASLIG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222863.11e-142PREDICTED: transcription factor MYB59
SwissprotQ9LX822e-55MYB48_ARATH; Transcription factor MYB48
TrEMBLM5W1561e-129M5W156_PRUPE; Uncharacterized protein (Fragment)
STRINGVIT_06s0004g04140.t012e-67(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46130.21e-54myb domain protein 48