PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G080100.1.p
Common NamePRUPE_ppa021063mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family WOX
Protein Properties Length: 227aa    MW: 25297.2 Da    PI: 8.5533
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G080100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox46.85.1e-152491557
                        HHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
            Homeobox 15 LeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                        Le+++++  r+psae++++L+++l    +++ ++V++WFqN++a++++
  Prupe.6G080100.1.p  2 LENFYRQgIRTPSAEQIQQLTSRLraygHIEGKNVFYWFQNHKARQRQ 49
                        999***99**************************************97 PP

2Wus_type_Homeobox85.84.8e-281511565
   Wus_type_Homeobox 15 iLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                        +Le+ y++G+rtP++e+iq++t++L++yG+ie+kNVfyWFQN+kaR+rqkq
  Prupe.6G080100.1.p  1 MLENFYRQGIRTPSAEQIQQLTSRLRAYGHIEGKNVFYWFQNHKARQRQKQ 51
                        69***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.803150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-5149IPR009057Homeodomain-like
SuperFamilySSF466896.53E-9258IPR009057Homeodomain-like
CDDcd000863.80E-4251No hitNo description
PfamPF000461.0E-12249IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MLENFYRQGI RTPSAEQIQQ LTSRLRAYGH IEGKNVFYWF QNHKARQRQK QKQESVAYLN  60
PFFHMTSQSM FPPPPPPLNH HPCPNVMCSP YYIPVQNELG FYQQSPYPYK VPFPGGAKGK  120
PRTEKSVKPR TTHTGGSGYE PMPHGYSTSG GGYMINDVAN ESTGRCDQET LPLFPLQPTG  180
ILQGREYQNP SCGSGTANYA DNSTAALIGS NSEIVGDQPF YDFFSG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007207641.11e-169hypothetical protein PRUPE_ppa021063mg
TrEMBLM5WPU91e-169M5WPU9_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03460.13e-56(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.17e-42WUSCHEL related homeobox 2