PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G073900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 785aa    MW: 88209.9 Da    PI: 5.5755
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G073900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3642e-1114077811373
                GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPil 91 
                         l++lL+ cA+avss+d++ +++lL+++++++spdgd  qRla++f++AL+ar+a++++++    ++ +++++ ++++l+a+++   ++P+ 
  Prupe.6G073900.1.p 407 LRNLLILCAQAVSSNDFRTTSELLKQVRQHSSPDGDGSQRLAHFFANALEARMAGTGTGTQIFYASLASKRTAVVDTLKAYQVHLSACPFK 497
                         6899***************************************************888888777888888888****************** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnv 180
                         ++s +  N++Il+ +e+++++Hi+Df+i +G+QWp L+q L++Rp+gpp+lRiTg++ p++g   ++ +eetg+rLak++e+++vpfe+n+
  Prupe.6G073900.1.p 498 RISIFFKNKMILKMAEKATTLHIVDFGILYGFQWPLLIQHLSKRPGGPPKLRITGIEIPQPGfrPADWIEETGRRLAKYCERFNVPFEYNA 588
                         *************************************************************999*************************** PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl 271
                         ++++++e+++le+L+++++E+laVn++l+ ++ll+e+v+++ +rd+vLkl+++++P+++v++  + ++n++ F++rf eal ++sal+d++
  Prupe.6G073900.1.p 589 IASQNWESIKLEDLKTERNEVLAVNCMLRFKNLLEETVEVNCPRDSVLKLIRRMKPDIFVHTIVNGSYNAPFFVTRFREALFHFSALYDAF 679
                         *999*************************************************************************************** PP

                GRAS 272 eaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgW 362
                         + +++r++eer + Ere+ gre++nv+a eg er+er et+++W+ r ++aG++p+pl++++ k  k  ++  + + + ++++s+++++gW
  Prupe.6G073900.1.p 680 DINIARDNEERLMFEREFYGREAMNVIAFEGLERVERPETYKQWQVRCTRAGLRPLPLDQDMLKIFKDKVKAWYHKDFVIDQDSDWMLQGW 770
                         **************************************************************************888************** PP

                GRAS 363 kdrpLvsvSaW 373
                         k+r +++ S+W
  Prupe.6G073900.1.p 771 KGRIVYASSCW 781
                         *********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.29381762IPR005202Transcription factor GRAS
PfamPF035147.0E-109407781IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 785 aa     Download sequence    Send to blast
MDPTINGVPD YTNGFNIDAQ SFLPNSTQFP NLTNEYQFNQ LSPDLNFLDN HFSLPSPDLE  60
PGNFVPSISV SSDGESFVPS TSLSPDGVSF APPMTTVSPG GDSSSDDNDF SETVFKFINQ  120
ILMEENIEKK PCMFYDPLGL RVTEKSFYDA LGQKYPSSPN QQPLYIDQNV ESPDGNFSGN  180
CSDCCGSNSS ASPGTSNSVD PPWLGDPVDQ KPSLSQTSLP NDHTFQFNSH PNSQLSVPLT  240
NDLTSVGDEL HVDNALQGSS FNRGLEEASK FLPKDNQLIV NLESNTTYPE VKRHAPTVIV  300
KKEKSERKNS PNGSRGRKNH ERGDVAPEEE RSSKQSAVYI QESELSEMFD RVLLCTGGNN  360
ESPCDNVAFQ NEASQALQPN GHPQESNGNG GKARAKKHEK KKETVDLRNL LILCAQAVSS  420
NDFRTTSELL KQVRQHSSPD GDGSQRLAHF FANALEARMA GTGTGTQIFY ASLASKRTAV  480
VDTLKAYQVH LSACPFKRIS IFFKNKMILK MAEKATTLHI VDFGILYGFQ WPLLIQHLSK  540
RPGGPPKLRI TGIEIPQPGF RPADWIEETG RRLAKYCERF NVPFEYNAIA SQNWESIKLE  600
DLKTERNEVL AVNCMLRFKN LLEETVEVNC PRDSVLKLIR RMKPDIFVHT IVNGSYNAPF  660
FVTRFREALF HFSALYDAFD INIARDNEER LMFEREFYGR EAMNVIAFEG LERVERPETY  720
KQWQVRCTRA GLRPLPLDQD MLKIFKDKVK AWYHKDFVID QDSDWMLQGW KGRIVYASSC  780
WVPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-434117818374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008245986.10.0PREDICTED: scarecrow-like protein 33
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WK680.0M5WK68_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03800.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14