PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G073700.1.p
Common NamePRUPE_ppa026849mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 692aa    MW: 78813.9 Da    PI: 6.2244
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G073700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS389.44.1e-1193186892374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL++cA+av+s +++ a++lL+++++++sp+gd++qRla+yf+ +L+arla+  +  y+ l + + s    +e l+a+++f+  sP+ +
  Prupe.6G073700.1.p 318 STLLTQCAQAVASYEQRTASELLKQIRQHSSPYGDATQRLAHYFADGLEARLAGARTPSYSPLISMQIS---AAEILKAYEVFVTSSPFRT 405
                         579***************************************************989999888888887...8****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +s+++aN++Il+ +e+++r+H+iDf+is+G+QWp+++q L++Rp+gpp+lRiT+++ p++g   +e++eetg+rL+k+Ae+++vpfe+nv 
  Prupe.6G073700.1.p 406 VSNFLANRTILKLAEKATRLHVIDFGISYGFQWPCFIQRLSKRPGGPPKLRITAIELPQPGfrPTEKVEETGRRLKKYAERFNVPFEYNV- 495
                         ************************************************************9****************************9. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a+++e++++e+L+++++E+++Vn++ +l +++de+v ++s+rd vLkl+k+++P+++++   +  +ns+ F++rf eal ++salfd +e
  Prupe.6G073700.1.p 496 IAQKWETIQFEDLKIDRNEMIVVNCMNRLRHIPDETVMVNSPRDIVLKLIKKINPDLFIHGVVNGTYNSPFFVTRFREALFHFSALFDVFE 586
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgW 362
                         a++pre+e r + E+++ g++i nvvaceg er+er et+++W+ r  +aGFk++pl++++ k+++++l+ ++  + +r++ee +++++gW
  Prupe.6G073700.1.p 587 ASVPREDERRLMFEKAVYGKDILNVVACEGLERVERPETYKQWQVRNVRAGFKQLPLDQEILKKVERMLKFMGyHNDFRIDEEGHWILQGW 677
                         **********************************************************************9999999************** PP

                GRAS 363 kdrpLvsvSaWr 374
                         k+r+++++S+W+
  Prupe.6G073700.1.p 678 KGRTIMALSFWK 689
                         ***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098567.147291668IPR005202Transcription factor GRAS
PfamPF035141.4E-116318689IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 692 aa     Download sequence    Send to blast
MDNLLERYSL SLERFNFGHG LASTNLDHPS DSNTYLSSGS DGDTTDISDY NRPVIKYISD  60
ILLEEDLEGK PCMLQDCLTL QAAEKSFYDV LNQKDPLSPN QPPLSVHQSF ENSDDDSPHS  120
CHNSNASIAA KTNWVFDPSE TSKVQSSLVQ SLPDPGLDSD SLSEMQRLEY FGGLREASKF  180
LPNVKFETID LKGSQLMPPG LDQWPQATNT LMRRPDNDDY SSTNRSKGKK NHQRDDGDYP  240
EEGRSNKQPV AFADDSEPQE MFDEVLLCLG NHEFELCSND ESLITEGSGK LQHKKQSKGS  300
KTAGSKKQNN NRELVDLSTL LTQCAQAVAS YEQRTASELL KQIRQHSSPY GDATQRLAHY  360
FADGLEARLA GARTPSYSPL ISMQISAAEI LKAYEVFVTS SPFRTVSNFL ANRTILKLAE  420
KATRLHVIDF GISYGFQWPC FIQRLSKRPG GPPKLRITAI ELPQPGFRPT EKVEETGRRL  480
KKYAERFNVP FEYNVIAQKW ETIQFEDLKI DRNEMIVVNC MNRLRHIPDE TVMVNSPRDI  540
VLKLIKKINP DLFIHGVVNG TYNSPFFVTR FREALFHFSA LFDVFEASVP REDERRLMFE  600
KAVYGKDILN VVACEGLERV ERPETYKQWQ VRNVRAGFKQ LPLDQEILKK VERMLKFMGY  660
HNDFRIDEEG HWILQGWKGR TIMALSFWKK A*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-443216898375GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.199850.0fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208495.10.0hypothetical protein PRUPE_ppa026849mg
TrEMBLM5W7L00.0M5W7L0_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14