PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G073600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 685aa    MW: 77016.8 Da    PI: 6.086
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G073600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS377.41.8e-1153116802372
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          +lL+ecA+av s d++ a++lL+++++++sp+g ++qRla+yf+e+L+arla+  s  y  l   +    +++e l+a+++++ ++P+ k
  Prupe.6G073600.1.p 311 CKLLTECAQAVGSYDQQSASELLKQIRQHSSPYGYATQRLAHYFAEGLEARLAGARSLSYPPLLFMH---ASTTEILKAYQVYVSACPFKK 398
                         589***************************************************5555555444444...459****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         + h+ aN++I++ +e+++r+HiiDf+is+GlQWp+L+q+L+++++gpp+lRiT+++ p++g   +e++eetg+rLak+ ++ gvpfe+nv 
  Prupe.6G073600.1.p 399 MLHFFANRTIMKQTEKATRLHIIDFGISYGLQWPCLIQSLSEKAGGPPNLRITAIELPQPGfrPAERIEETGRRLAKYSKRYGVPFEYNV- 488
                         ************************************************************9****************************9. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +ak++e+++leeL+++++E+++Vn++++l++++de+v ++++rd+vL+l+k+++P+++ +   +  +n++ F++rf + l ++ alfd++e
  Prupe.6G073600.1.p 489 IAKKWETIRLEELQIDRNEVIVVNCMHRLKQIPDETVMMNNPRDAVLNLIKRINPDLFMHGVVNGTYNAPAFVTRFKQLLFHFQALFDMYE 579
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgW 362
                         a++pre+e+r   Er+++gr+i+nv+aceg er+er et+++W++r  +aGFk++pl+ +  k++k++ ++++  + + +e++ +++++gW
  Prupe.6G073600.1.p 580 ATVPREDEHRLLFERAIFGRDIMNVIACEGLERVERPETYKQWQARYVRAGFKQLPLDRELFKKVKTMSKMMGyHKDFGIEDDGEWMLQGW 670
                         ************************************************************************99999************** PP

                GRAS 363 kdrpLvsvSa 372
                         k+r ++++Sa
  Prupe.6G073600.1.p 671 KGRIILALSA 680
                         ********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.579284661IPR005202Transcription factor GRAS
PfamPF035146.1E-113311680IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 685 aa     Download sequence    Send to blast
MEELNFGHGS NSVSSDQNLV NGLQVNHEPT NKLLLPANLD RPSDSGTSSE GDTVDSSDCN  60
LPVLKYISDI LLEEDLEGKP CMLEDILGLQ AAEKSFYDAL NQKDPPLPNQ PSFSVYQSFE  120
NSDGGFQSSN GSIAAKTGSV WDFSETSHVQ TSPVESLSDT ALVSDSFSDM QSLGNFRGVG  180
EGNEIIDLEG YQCTPPGPNT LYRNLASVPE NYGYNSTNGS KGKKNHQREE GHYTEEGRSN  240
KQSAAFADDS DLQEMFDKVL QGVNPESESC FHDESLNAEG TRKLQHNKQS KGSKTTCSKK  300
PNSNRQVVDL CKLLTECAQA VGSYDQQSAS ELLKQIRQHS SPYGYATQRL AHYFAEGLEA  360
RLAGARSLSY PPLLFMHAST TEILKAYQVY VSACPFKKML HFFANRTIMK QTEKATRLHI  420
IDFGISYGLQ WPCLIQSLSE KAGGPPNLRI TAIELPQPGF RPAERIEETG RRLAKYSKRY  480
GVPFEYNVIA KKWETIRLEE LQIDRNEVIV VNCMHRLKQI PDETVMMNNP RDAVLNLIKR  540
INPDLFMHGV VNGTYNAPAF VTRFKQLLFH FQALFDMYEA TVPREDEHRL LFERAIFGRD  600
IMNVIACEGL ERVERPETYK QWQARYVRAG FKQLPLDREL FKKVKTMSKM MGYHKDFGIE  660
DDGEWMLQGW KGRIILALSA LKPA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-443146828375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008222397.10.0PREDICTED: scarecrow-like protein 14
TrEMBLM5WQX90.0M5WQX9_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.10.0GRAS family protein