PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G057300.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 328aa    MW: 37364 Da    PI: 4.9518
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G057300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM69.31e-21101413128
                 NAM   3 pGfrFhPtdeelvveyLkkkvegkk..lel.eevikevd.iykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknr.atksgyWka 85 
                         +GfrFhPtd+el++++L kkv +k+  + l ++++++++ + ++ePw         +  ++++yfFs+ ++ +++g+r +r + + g+W++
  Prupe.6G057300.1.p  10 VGFRFHPTDQELISYFLYKKVIAKQplMALySNIVHDFNlLGETEPWVVWDifgGPDLIDEDLYFFSELKNLSPKGSRIKRkIEAGGTWSE 100
                         7*******************988887733314569999725689***9964233223356799******************5555899**9 PP

                 NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                           ++k   +++g+ +g k+ L + +  +   ++ +W+++ey+l
  Prupe.6G057300.1.p 101 AFSKKVYDETTGNPIGRKRNLRYEN--EGCEHHGKWLLEEYSL 141
                         98865555559999********983..4444589*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100527.3568158IPR003441NAC domain
SuperFamilySSF1019418.37E-228157IPR003441NAC domain
PfamPF023652.0E-1610141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MTNYSGNRLV GFRFHPTDQE LISYFLYKKV IAKQPLMALY SNIVHDFNLL GETEPWVVWD  60
IFGGPDLIDE DLYFFSELKN LSPKGSRIKR KIEAGGTWSE AFSKKVYDET TGNPIGRKRN  120
LRYENEGCEH HGKWLLEEYS LVVDQETQKI VLCRLKKNNR VWNKINNSTQ ELKEKPSNKK  180
ARKGLGSPRI KIEDEEPHRT SGLSTVYNNL DQELIIDTNY NAISNNICGD NQDNMLITSD  240
FASAPVCYDY GGLIDEEYIF DVNELLATVE PQPLSLELPQ MAETLEPLLS SDRTVDAWNS  300
SGLENIYATN KKTSHIGSTV EKYFGNL*
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.6G057300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420688.10.0NAC domain-containing protein 101
TrEMBLA0A251NNG40.0A0A251NNG4_PRUPE; Uncharacterized protein
STRINGXP_008221120.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12591634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.15e-14NAC domain containing protein 83