PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G050400.1.p
Common NamePRUPE_ppa012275mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 177aa    MW: 19777.4 Da    PI: 7.0904
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G050400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.99.9e-4561051100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +Ca+Ck+lrr+CakdC++apyfp+++p+kfa vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+
  Prupe.6G050400.1.p   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFALVHKVFGASNVSKMLQELPIHQRGDAVSSLVYEANARVRDPVYGCVGAISFLQNQVSQLQ 96 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                          +la++++e
  Prupe.6G050400.1.p  97 MQLAVAQAE 105
                         *****9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7485106IPR004883Lateral organ boundaries, LOB
PfamPF031959.8E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGGTSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFALVHK VFGASNVSKM LQELPIHQRG  60
DAVSSLVYEA NARVRDPVYG CVGAISFLQN QVSQLQMQLA VAQAEILCIQ MQQEPVALPN  120
QIDHQHNHHH QDHDHDQKSL LLSNSDFNNI PHQYFSSFAS SSNVIQDPLK RESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007205998.11e-130hypothetical protein PRUPE_ppa012275mg
SwissprotQ8LBW31e-81LBD12_ARATH; LOB domain-containing protein 12
TrEMBLM5W0D71e-129M5W0D7_PRUPE; Uncharacterized protein
STRINGVIT_06s0004g07200.t011e-100(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-78LBD family protein