PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G043900.2.p
Common NamePRUPE_ppa019397mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 226aa    MW: 24526.8 Da    PI: 8.4757
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G043900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.81.4e-41321311100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdPvyG++gvi++lqqq+++l+
  Prupe.6G043900.2.p  32 PCAACKLLRRRCAEECPFSPYFSPHEPQKFSAVHKVFGASNVSKMLIEVAENQRADAANSLVYEANLRLRDPVYGCMGVISTLQQQIQSLQ 122
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++++e
  Prupe.6G043900.2.p 123 QELNAVRTE 131
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.70931132IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4132129IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MGTMSTARHN NSFGRPQGMM MMNNTTLNTI TPCAACKLLR RRCAEECPFS PYFSPHEPQK  60
FSAVHKVFGA SNVSKMLIEV AENQRADAAN SLVYEANLRL RDPVYGCMGV ISTLQQQIQS  120
LQQELNAVRT EILRYQYKEA TNHMVSSTNI MHHHPSLVST SGMVSIAGPP QAIPKPPPPP  180
PPPPPPSSSV VFSSSSSSSA SSLYNPSTNT TGYSSMSSDN IPYFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206519.11e-166hypothetical protein PRUPE_ppa019397mg, partial
SwissprotQ9AT616e-72LBD13_ARATH; LOB domain-containing protein 13
TrEMBLM5WEL41e-166M5WEL4_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0013s15220.13e-78(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.14e-59LOB domain-containing protein 13