PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.6G043900.1.p
Common NamePRUPE_ppa019397mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 254aa    MW: 27755.3 Da    PI: 7.9137
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.6G043900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.41.9e-41601591100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+Ca++C+++pyf  ++p+kf +vhk+FGasnv+k+l ++ e++r da++slvyeA+ r+rdPvyG++gvi++lqqq+++l+
  Prupe.6G043900.1.p  60 PCAACKLLRRRCAEECPFSPYFSPHEPQKFSAVHKVFGASNVSKMLIEVAENQRADAANSLVYEANLRLRDPVYGCMGVISTLQQQIQSLQ 150
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         +el+++++e
  Prupe.6G043900.1.p 151 QELNAVRTE 159
                         ****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.70959160IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-4160157IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MSRDRDIITL DEIGKKIRRE SDPSGDDQMG TMSTARHNNS FGRPQGMMMM NNTTLNTITP  60
CAACKLLRRR CAEECPFSPY FSPHEPQKFS AVHKVFGASN VSKMLIEVAE NQRADAANSL  120
VYEANLRLRD PVYGCMGVIS TLQQQIQSLQ QELNAVRTEI LRYQYKEATN HMVSSTNIMH  180
HHPSLVSTSG MVSIAGPPQA IPKPPPPPPP PPPPSSSVVF SSSSSSSASS LYNPSTNTTG  240
YSSMSSDNIP YFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007206519.10.0hypothetical protein PRUPE_ppa019397mg, partial
SwissprotQ9AT617e-73LBD13_ARATH; LOB domain-containing protein 13
TrEMBLM5WEL40.0M5WEL4_PRUPE; Uncharacterized protein (Fragment)
STRINGPOPTR_0013s15220.15e-84(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-61LOB domain-containing protein 15