PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G238100.1.p
Common NamePRUPE_ppa016187mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 444aa    MW: 49184.2 Da    PI: 7.1376
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G238100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32322375255
             G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         pr+rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Prupe.5G238100.1.p 322 PRMRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 375
                         9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15319376IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-28320376IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23322375IPR006447Myb domain, plants
PfamPF002492.5E-7323374IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 444 aa     Download sequence    Send to blast
MPHEKGISEA AGSCRLSLNP IPDLSLHISP PNANTNKNAN SAPSSICTDQ STNEAPNHHE  60
SGSCFDIWCR DMDGDGLINK SHSDSCVRRG SCSLVAAADH DTELSLANPT ASEAESRWRK  120
NYFNTRGGGG EGRRHHLHHH EEEEEAKTSI SHGFSMLDVA ERLKPIKGIP VYNCPPTNCS  180
FPPNLEDQSH YSRVDRDQRD DFDSNKLRLY LSNSLRPAAP AANSCSGMGM GMGMGFESAM  240
SRTFNGMTMD SLSQRQHYFP SYNLNHLQQQ QQQQCSVGGV SGGANYSYNY NSDLPSNGFI  300
MRSRFTPTKL SQNINKRNMR APRMRWTTSL HARFVHAVEL LGGHERATPK SVLELMDVKD  360
LTLAHVKSHL QMYRTVKNTD KPLGSSDGSG DEDLLSTTTT HHHNSSALLN QRGASNLEHD  420
MEHHHHPSSN NLWGNSSRYD LHL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-17323377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-17323377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-17323377357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-17323377357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G238100.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420450.10.0transcription repressor KAN1 isoform X2
TrEMBLA0A251PCY00.0A0A251PCY0_PRUPE; Uncharacterized protein
STRINGEMJ122860.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-38G2-like family protein