PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G221600.1.p
Common NamePRUPE_ppa007839mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 355aa    MW: 39694.4 Da    PI: 7.4618
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G221600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM173.56.5e-5451311129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL+ kv++ +++  ++++ vd++k+ePwdLp k++ +ekewyfF  rd+ky+tg r+nrat++gyWk+tgkdk+
  Prupe.5G221600.1.p   5 LPPGFRFHPTDEELITYYLCCKVSDVSFTS-KAVAVVDLNKCEPWDLPGKASMGEKEWYFFNLRDRKYPTGLRTNRATEAGYWKTTGKDKD 94 
                         79*************************999.88***************988999************************************* PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++  g lvg+kktLvfykgrap+gek++Wvmheyrle
  Prupe.5G221600.1.p  95 IHR-AGVLVGMKKTLVFYKGRAPRGEKSNWVMHEYRLE 131
                         **9.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.32E-623151IPR003441NAC domain
PROSITE profilePS5100558.6125151IPR003441NAC domain
PfamPF023658.3E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MQDSLPPGFR FHPTDEELIT YYLCCKVSDV SFTSKAVAVV DLNKCEPWDL PGKASMGEKE  60
WYFFNLRDRK YPTGLRTNRA TEAGYWKTTG KDKDIHRAGV LVGMKKTLVF YKGRAPRGEK  120
SNWVMHEYRL ENKHPFKSSK EEWVVCRVFQ KSISLKKPQQ TTTSSQQQQQ TSIESPCEET  180
NSIVNEFGDI ELPNLNSNNI ANSSSGLIST MSSTQSCYNN NINDHSSDVN MSLNMNWGAA  240
REAAASALPT LTWPWPSNLL TPSNLSVNSL LLRALQLRSS NTGAATLDPS YSYNNNNINI  300
NMEQGMPRPM SQFGSGTSAD MNSNFQASSS TRDMMEAVPP QQHPAQPFNL DSIW*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-57215714171NO APICAL MERISTEM PROTEIN
1ut4_B4e-57215714171NO APICAL MERISTEM PROTEIN
1ut7_A4e-57215714171NO APICAL MERISTEM PROTEIN
1ut7_B4e-57215714171NO APICAL MERISTEM PROTEIN
4dul_A4e-57215714171NAC domain-containing protein 19
4dul_B4e-57215714171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G221600.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209301.10.0protein CUP-SHAPED COTYLEDON 1
TrEMBLM5WUQ10.0M5WUQ1_PRUPE; Uncharacterized protein
STRINGEMJ105000.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF49463356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-101NAC domain containing protein 58