PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G208300.1.p
Common NamePRUPE_ppa003644mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 560aa    MW: 61263.1 Da    PI: 7.4377
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G208300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.61.3e-41177252277
                         -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                 SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                         Cqv gC++dls+ k+yh+rhkvCe+hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Prupe.5G208300.1.p 177 CQVYGCNKDLSSSKDYHKRHKVCEAHSKTAKVIVNGREQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 252
                         **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.1E-34172238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.368174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.18E-38175255IPR004333Transcription factor, SBP-box
PfamPF031109.3E-32177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MESWSRISEG KGFVSEETIS HTDSFSRSRN TLMGWELKIP CTFGSNVLVS GQQAIESQGF  60
GELGFPEMMG KHFSNNPIRD VLSGKVYGER STNTTSMATP NLFSGEDESS SKLSSSIVDS  120
NSRDSSLIDL KLGRLADNRD FHDSKFSKGH PILSSSESST PPKRMRVSGL YSQTAYCQVY  180
GCNKDLSSSK DYHKRHKVCE AHSKTAKVIV NGREQRFCQQ CSRFHLLAEF DDGKRSCRKR  240
LAGHNERRRK PQVGIHSGRA GRLLQSYNGS RFQDNMLTTA SFICQEILPS GILDAENYGT  300
NDWCRHLKVE DATHYRPLSG VPVTNGHLPL KPAFPSYDIG KRYPPFHDNG TNPLTGNIII  360
ENGSQYSHDM RGLNSGSHSM FHETTTLGSE DFNVFNTAST VHGLSGISDS GCALSLLSSQ  420
SQKSSSHLSG IPMASPLVMP DRHTNYRLVQ GSENLIGGCS HASSSGVSNK FPSSGMNSGA  480
GTHLGPILLC NGSDTDDFGI SDGIFQGSDF VNAKDRLSCE DGTTIDLLQL SSQLQRVEDQ  540
RQSMQVKQES DAFCCLRIT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-281772501184squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G208300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819325e-46LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132665e-46LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209100.10.0teosinte glume architecture 1 isoform X1
RefseqXP_020418904.10.0teosinte glume architecture 1 isoform X1
TrEMBLM5W9A50.0M5W9A5_PRUPE; Uncharacterized protein
STRINGEMJ102990.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-50SBP family protein