PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G203200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 183aa    MW: 20966.4 Da    PI: 6.6756
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G203200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM105.47.3e-33161511128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevd...iykvePwdLpkkvkaeekewyfFskrdkkya....tgkrknratk..sgy 82 
                         lp+GfrF Ptd+elv++yL +kv +++++++e+i+++d    y+++P++L  +++ +e+ew+fF+++d ++     +g+r+ r++    g+
  Prupe.5G203200.1.p  16 LPVGFRFMPTDKELVTHYLMNKVFDRPVPAAEAIQDIDatqFYSTHPKNLV-TFSCGEREWFFFIHEDDENCspsaQGRRNIRVVGngVGF 105
                         79*************************998888888764448999*****6.777899******999988764554677777765534678 PP

                 NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         Wk  g+++++++++g++   k  L++++g+ +k++kt+W m ey+l
  Prupe.5G203200.1.p 106 WKPNGSENPIHNEDGNVCASKIFLTYFSGSLRKAKKTHWKMVEYHL 151
                         *********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.29E-3310171IPR003441NAC domain
PROSITE profilePS5100532.70416176IPR003441NAC domain
PfamPF023657.0E-1817151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEAEHGQEAM MSSGQLPVGF RFMPTDKELV THYLMNKVFD RPVPAAEAIQ DIDATQFYST  60
HPKNLVTFSC GEREWFFFIH EDDENCSPSA QGRRNIRVVG NGVGFWKPNG SENPIHNEDG  120
NVCASKIFLT YFSGSLRKAK KTHWKMVEYH LHSDSHTEEE YQVQRREWVL GQLKRGNAYN  180
GH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-1711733165Stress-induced transcription factor NAC1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G203200.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420381.11e-138NAC transcription factor 29-like
TrEMBLA0A251PB641e-137A0A251PB64_PRUPE; Uncharacterized protein
STRINGXP_004301123.14e-75(Fragaria vesca)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144391218
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-21NAC domain containing protein 32