PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G196000.1.p
Common NamePRUPE_ppa007653mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 361aa    MW: 40482.7 Da    PI: 7.9668
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G196000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.54.4e-56171431129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeel+++yL+kkv + ++++ ++i evd++k+ePwdLp k+k +ekewyfF+ rd+ky+tg r+nrat++gyWkatgkdke
  Prupe.5G196000.1.p  17 LPPGFRFHPTDEELISHYLHKKVIDISFSC-KAIGEVDLNKSEPWDLPGKAKMGEKEWYFFCVRDRKYPTGLRTNRATEAGYWKATGKDKE 106
                         79****************************.88***************99999************************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                         +++ +++lvg+kktLvfy+grapkgek++Wvmheyrle
  Prupe.5G196000.1.p 107 IYK-GKSLVGMKKTLVFYRGRAPKGEKSNWVMHEYRLE 143
                         ***.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-658167IPR003441NAC domain
PROSITE profilePS5100560.08917167IPR003441NAC domain
PfamPF023651.5E-2918142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEHVPAGMVE QYEQIDLPPG FRFHPTDEEL ISHYLHKKVI DISFSCKAIG EVDLNKSEPW  60
DLPGKAKMGE KEWYFFCVRD RKYPTGLRTN RATEAGYWKA TGKDKEIYKG KSLVGMKKTL  120
VFYRGRAPKG EKSNWVMHEY RLEGKFSVHN LPKTAKNEWV ICRVFEKNSG GKKTHISGFV  180
RYGALGNEMD PSGLPPLMDS SPYSSKTKLA SESSYVPCFS NPDPTDVQRN QGIVDYMNNP  240
LFGVSSNTSN FFPRAPFSTS FYSAQSAPVA ANFQFPGSVL MQDQSILRAL LENNGSNMRQ  300
SFKTEREMVS VSQETGLTSE MNTEISSVMS NLEMGRRPFG DQEAPAAAAG AVDLDNFWNY  360
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-5631733171NO APICAL MERISTEM PROTEIN
1ut4_B4e-5631733171NO APICAL MERISTEM PROTEIN
1ut7_A4e-5631733171NO APICAL MERISTEM PROTEIN
1ut7_B4e-5631733171NO APICAL MERISTEM PROTEIN
4dul_A4e-5631733171NAC domain-containing protein 19
4dul_B4e-5631733171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.162730.0fruit
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G196000.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209288.10.0NAC domain-containing protein 100
SwissprotQ9FLJ21e-161NC100_ARATH; NAC domain-containing protein 100
TrEMBLM5W9R30.0M5W9R3_PRUPE; Uncharacterized protein
STRINGEMJ104870.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40934171
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-159NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]