PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G193900.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family Nin-like
Protein Properties Length: 304aa    MW: 34770.2 Da    PI: 4.7823
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G193900.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK84.21.2e-26133183252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         +k +s e++s+yF++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk++sl
  Prupe.5G193900.1.p 133 SKMLSRETISNYFYMPITQAAKELNVGLTLLKKRCRELGIRRWPHRKLASL 183
                         57899*******************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.905114203IPR003035RWP-RK domain
PfamPF020421.6E-21136183IPR003035RWP-RK domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051302Biological Processregulation of cell division
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MNGYGPFDWQ CEWTLPQVQD SFLDAAVPFM DQSCLNLDPL YSSLDIQPIR SAFQGDEIVL  60
GNGDGVCNDL FCELMEPSNN QQKQIHQPPL LMCKNEENGS AANELEEETK VISKRSHLST  120
RLRSSNSTSL NSSKMLSRET ISNYFYMPIT QAAKELNVGL TLLKKRCREL GIRRWPHRKL  180
ASLQTLIRNI QELGKEGEES EEKLRNAIQL LERERKLLEE VPDMQLEDNT KRLRQACFKA  240
NYKKRKIMGM NNMDQSQSSF ICSNNEIHEY ASIMDDGYEE DEEIKSLLSD SFSSSNSNNI  300
CLF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00234DAPTransfer from AT1G74480Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G193900.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007210155.20.0protein RKD1
TrEMBLA0A251PAS30.0A0A251PAS3_PRUPE; Uncharacterized protein
STRINGXP_008239990.11e-174(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18790.12e-40RWP-RK domain-containing protein