PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G184500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 362aa    MW: 41074.4 Da    PI: 5.7324
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G184500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.85.1e-40711711101
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         aCaaCk++rrkC+++C+lap fpa+qpk f+n+hklFG+sn++k+lk+l++e + +am+s++y+A++r + PvyG+ +vi++lq ql  ++
  Prupe.5G184500.1.p  71 ACAACKYQRRKCTPECPLAPFFPADQPKMFQNAHKLFGVSNIVKILKNLEPEMKFEAMRSIIYQANIRDKFPVYGCWEVIWQLQYQLLLAE 161
                         7****************************************************************************************** PP

              DUF260  92 aelallkeel 101
                         +el++++++l
  Prupe.5G184500.1.p 162 EELQAVQAQL 171
                         *****99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.91670171IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-3871168IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MSPILLPTIS SFTFFFFFLL LLILVQLIAT LLLLLKRSSN CFLGFSFSRL PLWFQSLFSP  60
NMTLKGATNS ACAACKYQRR KCTPECPLAP FFPADQPKMF QNAHKLFGVS NIVKILKNLE  120
PEMKFEAMRS IIYQANIRDK FPVYGCWEVI WQLQYQLLLA EEELQAVQAQ LAMYRQHHHH  180
QHQISSVPEY VTSQLELGMA PPNNSLPLFN HNPQPYNNNN NNAMPALPVT QHHHQQQSYS  240
NSSDAAYSSV YIDSKDNNAA NPLWVSNPCT TNNNSNNDNS ETIQSQLGVL QPLSLQPDVV  300
QDYDELHPFF DTIDDRQSYI DSKEAYESSS EESFKDTTQS MEYAENALKN AASCFSLTSV  360
N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208828.10.0hypothetical protein PRUPE_ppa025223mg
TrEMBLM5W8G80.0M5W8G8_PRUPE; Uncharacterized protein
STRINGPOPTR_0012s07390.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.14e-38LOB domain-containing protein 27