PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G182000.1.p
Common NamePRUPE_ppa009283mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 299aa    MW: 32493.2 Da    PI: 7.8165
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G182000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.7e-1488132347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  Prupe.5G182000.1.p  88 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 132
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.83681137IPR017930Myb domain
SuperFamilySSF466894.41E-1783138IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-1784135IPR006447Myb domain, plants
SMARTSM007171.8E-1085135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-1187132IPR009057Homeodomain-like
PfamPF002491.7E-1188132IPR001005SANT/Myb domain
CDDcd001671.65E-988133No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MAGTCSTVEP AGAGEIMLFG VRVVIDSMRK SVSLNNLSQY EQPQEGSNNN SGNNTIAGKD  60
DVAGYASEND VVHNSGGNRE RERKRGVPWT EEEHKLFLLG LQKVGKGDWR GISRNFVKTR  120
TPTQVASHAQ KYFLRRNNHN RRRRRSSLFD ITTDTVTATP MDEEQVHHQN NTSQSHPLPP  180
PPPSEACNPS GFSMVPNFSL TVGPAVLPVP IENPMGNLTL GHANLENNAS AKLVRPIALH  240
SAPHATEMSD LNLKSTMDTS TLTLNLSLSM DPRESSSRHS AFQAMPSFSN GDSIISVA*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.58750.0fruit| leaf
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209410.10.0hypothetical protein PRUPE_ppa009283mg
SwissprotQ2V9B07e-73MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLM5WA620.0M5WA62_PRUPE; Uncharacterized protein
STRINGGLYMA05G01640.11e-91(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.15e-58MYB_related family protein