PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G167800.1.p
Common NamePRUPE_ppa023059mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 193aa    MW: 21308 Da    PI: 8.1368
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G167800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.7e-4511109199
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+kll++l +++reda++sl+yeAear+rdPvyG+vg i+ lq+q+++l+
  Prupe.5G167800.1.p  11 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKLLNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQRQVQRLQ 101
                         7****************************************************************************************** PP

              DUF260  92 aelallke 99 
                         +el+++++
  Prupe.5G167800.1.p 102 KELDSANA 109
                         ***99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.78610111IPR004883Lateral organ boundaries, LOB
PfamPF031954.4E-4411108IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MASSSSSYNS PCAACKFLRR KCMPGCIFAP YFPPEEPQKF ANVHKIFGAS NVTKLLNELL  60
PHQREDAVNS LAYEAEARVR DPVYGCVGAI SFLQRQVQRL QKELDSANAD LIRYACNEIT  120
TATVLPTGLN SVIQPNMAPR RRSVDHHPHH QFYQQINNTS TTGGAFSAPY LPWNDIHNRS  180
GDINEGGGDG RM*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007210963.11e-145hypothetical protein PRUPE_ppa023059mg
SwissprotQ9FML41e-80LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLM5WEF81e-145M5WEF8_PRUPE; Uncharacterized protein
STRINGPOPTR_0015s09370.13e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.49e-79LBD family protein