PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G147600.2.p
Common NamePRUPE_ppa003602mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 419aa    MW: 45903.7 Da    PI: 4.9902
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G147600.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.11.9e-08106146345
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                          WT+ E +ll++ v ++G + W+ +a+ ++ ++t  +c+ ++ 
  Prupe.5G147600.2.p 106 EWTESETLLLLESVLKHGDD-WEFVAQNVQ-TKTKFDCIAKLI 146
                         7*****************88.*********.*******98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129314.363102153IPR017884SANT domain
SuperFamilySSF466891.33E-8102152IPR009057Homeodomain-like
SMARTSM007172.1E-6103151IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-5105141IPR009057Homeodomain-like
CDDcd001674.23E-6106144No hitNo description
PfamPF002491.4E-8106146IPR001005SANT/Myb domain
PfamPF164951.8E-20328401IPR032451SMARCC, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MPNSIKPILP ISAPPKAGDA GGGVVNRITL APLASYSDVF GGLKKEEGLV CGNCGGHCET  60
GHYKYSKGDF LICIKCFENG NYGENKLRDD FKLNEAIEKS GTNGVEWTES ETLLLLESVL  120
KHGDDWEFVA QNVQTKTKFD CIAKLIDLPF GELVLGSAYR KGNPSSFSGN LISSERIQLS  180
SSECQDTVET NGQLHEQTDD CKQNGDILDQ DPPLKRQRIA SLSDASSSLI KQVAAITTMV  240
GPHITSAAAE AAVNALCEET SCSREIFNAD DDSIPNGLWS PAKNCETERV HGEDSEMKER  300
PTQSESRHAI FKKDDIPPTL QIRAAIGTAL GAAAAHAKLL ADQEDRQIEH LMATIIGTQM  360
KKLHSKLKHF EDLELIRKKE CAQIEEVEDI LVEERMNILQ RTFDSGVPRW RDHPSLKS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209093.10.0hypothetical protein PRUPE_ppa003602mg
TrEMBLM5W9780.0M5W978_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g00990.t011e-140(Vitis vinifera)