PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G146100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 265aa    MW: 29871.6 Da    PI: 7.9978
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G146100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.33.2e-49451691128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdeelv +yL+ kv + +l++ ++i+ev+++ ++PwdLp      e+e yfFs++++ky++g+r+nr+t+sgyWkatg+dk+
  Prupe.5G146100.1.p  45 LPPGFRFQPTDEELVFQYLRCKVFSCPLPA-SIIPEVNVCMYDPWDLPGD---LEQERYFFSNKESKYRNGSRANRVTSSGYWKATGTDKK 131
                         79****************************.89***************54...46799********************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++ vg kktLvfy+g+ap+g ktdWvmhey l
  Prupe.5G146100.1.p 132 IVSSrRNHIVGKKKTLVFYRGKAPNGCKTDWVMHEYCL 169
                         *99867778***************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.84E-5834199IPR003441NAC domain
PROSITE profilePS5100554.97545199IPR003441NAC domain
PfamPF023658.4E-2546169IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MVARHSSSQL TEAIKNQEKG FHFCFCFCFS TMDKFNFVRN GMIRLPPGFR FQPTDEELVF  60
QYLRCKVFSC PLPASIIPEV NVCMYDPWDL PGDLEQERYF FSNKESKYRN GSRANRVTSS  120
GYWKATGTDK KIVSSRRNHI VGKKKTLVFY RGKAPNGCKT DWVMHEYCLV NAETTASINT  180
AENALNEKEN WVLCRIFSKK RSCKTDDEEG IRVNNAEMVH APQTNNNQSP VSSSSSCSSS  240
SGITEVTSSS EAGDEEEISG CTKF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-474320415170NO APICAL MERISTEM PROTEIN
1ut4_B3e-474320415170NO APICAL MERISTEM PROTEIN
1ut7_A3e-474320415170NO APICAL MERISTEM PROTEIN
1ut7_B3e-474320415170NO APICAL MERISTEM PROTEIN
3swm_A3e-474320418173NAC domain-containing protein 19
3swm_B3e-474320418173NAC domain-containing protein 19
3swm_C3e-474320418173NAC domain-containing protein 19
3swm_D3e-474320418173NAC domain-containing protein 19
3swp_A3e-474320418173NAC domain-containing protein 19
3swp_B3e-474320418173NAC domain-containing protein 19
3swp_C3e-474320418173NAC domain-containing protein 19
3swp_D3e-474320418173NAC domain-containing protein 19
4dul_A3e-474320415170NAC domain-containing protein 19
4dul_B3e-474320415170NAC domain-containing protein 19
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}.
UniprotTISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G146100.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211149.20.0NAC domain-containing protein 83
SwissprotQ9FY931e-76NAC83_ARATH; NAC domain-containing protein 83
TrEMBLA0A251PA180.0A0A251PA18_PRUPE; Uncharacterized protein
STRINGEMJ123481e-174(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.13e-78NAC domain containing protein 83
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]