PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G113500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 274aa    MW: 29687.1 Da    PI: 6.4147
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G113500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_153.55.3e-17142204163
                         XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         e+++kre+rkq NRe+ArrsR RK+ae eeL + +++L +e +aLk++leelk  ++kl+ e+
  Prupe.5G113500.1.p 142 ERQVKREKRKQANRESARRSRMRKQAEYEELVRTFESLNTEKMALKSKLEELKGDSEKLRLEN 204
                         799********************************************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.0E-12141201No hitNo description
PfamPF001702.4E-15142204IPR004827Basic-leucine zipper domain
SMARTSM003381.5E-13142206IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.45144207IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.25E-8145200No hitNo description
CDDcd147024.16E-17147193No hitNo description
PROSITE patternPS000360149164IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MDQDVKKKLK GLDGTAVPVG YDSLKDTGHP VLEASKSLEQ NIDGLTDGSD GNTKEDNHHT  60
QRNNGSGSMR FADNDVKVHT QVRPTTNGEV NENSTNASGT GSPAGFLGVS LRSPYEKIGI  120
STAFVAPSAG AGLPFDAMVL DERQVKREKR KQANRESARR SRMRKQAEYE ELVRTFESLN  180
TEKMALKSKL EELKGDSEKL RLENATLMEK LKHAQVVPKG GIASVEIEVD LDLPTGTENI  240
LSNLGSVSRN AQLDCEAHES SMSETKLHAV AAR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1158165RRSRMRKQ
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G113500.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020420277.10.0G-box-binding factor 3 isoform X1
RefseqXP_020420278.10.0G-box-binding factor 3 isoform X1
TrEMBLA0A251P6Z40.0A0A251P6Z4_PRUPE; Uncharacterized protein
STRINGXP_008239083.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15470810
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46270.11e-26G-box binding factor 3