PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G072300.2.p
Common NamePRUPE_ppa001561mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 756aa    MW: 82196.4 Da    PI: 6.5478
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G072300.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3298.8e-1013917542374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                          ++L+++Ae v +g+++ aq +Larl+++ sp g+p+qR+a+yf+eAL+  l+ + + +  + pp++ ++ +++ ++ a+k+fsevsP+++
  Prupe.5G072300.2.p 391 LDQLYKAAELVGTGNFSHAQGILARLNHQLSPVGKPLQRAAFYFKEALQLLLLMNNPAT--SPPPRTPTPFDVIFKMGAYKVFSEVSPLIQ 479
                         679**************************************************955554..57888999999******************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp..egppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvl 181
                         f ++t+Nqa+leav+  +++Hi+Dfdi+ G++W++++q+L  R+  + +pslRiT+++sp++++  el  ++++L++fA+e+g++fe +v+
  Prupe.5G072300.2.p 480 FVNFTCNQALLEAVSDTDQIHIVDFDIGFGAHWASFMQELPVRNrgATAPSLRITAFASPSTHHPVELGLMRDNLTQFANEIGISFELEVV 570
                         *****************************************999556699****************************************9 PP

                GRAS 182 vakrledl..eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfds 270
                           ++l++   +l  +r + +E++aVn+ +   ++ +++++l++    +L++vk+lsPk++v  ++ +d+++ +F +++l+al+ y  l++s
  Prupe.5G072300.2.p 571 NFDSLDQSsySLPIFRANDNETVAVNFPI--WSTSNQPAALPN----LLRFVKQLSPKIMVSLDRGCDRSDLPFPQHILQALQSYINLLES 655
                         8887777622444567777********99..666678999999....******************************************** PP

                GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlg 361
                         l+a    +s++ +k+Er+ll+++i++ v  + +       ++  W+  + +aGF+pvp+s+++++qa++++++++ +g++ve++++slvl+
  Prupe.5G072300.2.p 656 LDAV-NVTSDAVNKIERFLLQPKIESTVLGRLRT----PDKMPLWKTLFASAGFTPVPFSNFTETQAECVVKRTPARGFHVEKRQESLVLC 741
                         *665.579********************998887....9999************************************************* PP

                GRAS 362 WkdrpLvsvSaWr 374
                         W++r+L+s+SaWr
  Prupe.5G072300.2.p 742 WQRRELISASAWR 754
                         ************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098544.547364734IPR005202Transcription factor GRAS
PfamPF035143.1E-98391754IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MRRSPSPPTS ASTLSSSFNG GGGGGGDKTT PLAAETSPPV GPASTKDEWA CELQSIPSGG  60
LEAVTGSGGV ERCGLGLGGL EDWETMLSGT AASPGQDQSL LRWIAGDVDD TSFGLKQLLQ  120
SGNQNGSNNN NSNPLDFDGN AGLGIVDQGP GFDLIGSSVS GTSVSGPNFG FSSSGFVSNG  180
NNSSNGKVGF VPGSSGLLNY KVSNVGFMHN NNSGGGNSVN CNIQNPIFFN SSNTMALPVS  240
LPLGHVVYQQ QQFESSPDEK PQILNPQLFM NNQNQQSQLS QNPNFFMPLA YAQQEQHHLL  300
QSQAKRHNSG GIVDPGSHQI QKVQFSDPGH EFLLRKHQQQ QQQQFGYPQG MQFLPQQHHV  360
PQKPLMVPKP KVAVGHGEEM AHQQQLQHTL LDQLYKAAEL VGTGNFSHAQ GILARLNHQL  420
SPVGKPLQRA AFYFKEALQL LLLMNNPATS PPPRTPTPFD VIFKMGAYKV FSEVSPLIQF  480
VNFTCNQALL EAVSDTDQIH IVDFDIGFGA HWASFMQELP VRNRGATAPS LRITAFASPS  540
THHPVELGLM RDNLTQFANE IGISFELEVV NFDSLDQSSY SLPIFRANDN ETVAVNFPIW  600
STSNQPAALP NLLRFVKQLS PKIMVSLDRG CDRSDLPFPQ HILQALQSYI NLLESLDAVN  660
VTSDAVNKIE RFLLQPKIES TVLGRLRTPD KMPLWKTLFA SAGFTPVPFS NFTETQAECV  720
VKRTPARGFH VEKRQESLVL CWQRRELISA SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3140975422375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008238556.10.0PREDICTED: scarecrow-like protein 27
TrEMBLM5WE330.0M5WE33_PRUPE; Uncharacterized protein
STRINGPOPTR_0003s11020.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-119GRAS family protein