PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G040400.2.p
Common NamePRUPE_ppa007828mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 284aa    MW: 32048 Da    PI: 5.9073
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G040400.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM99.45.3e-3127257128
                 NAM  57 ewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ew+fF+ rd+ky++g+r+nratk+gyWkatgkd++v++ +++++g +ktLvfy+grap g +tdW+mheyrl
  Prupe.5G040400.2.p   2 EWFFFCARDRKYPNGSRTNRATKAGYWKATGKDRKVVC-QSTVTGYRKTLVFYRGRAPLGDRTDWIMHEYRL 72 
                         8*************************************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100537.745195IPR003441NAC domain
SuperFamilySSF1019415.36E-35295IPR003441NAC domain
PfamPF023654.7E-15372IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008283Biological Processcell proliferation
GO:0071365Biological Processcellular response to auxin stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MEWFFFCARD RKYPNGSRTN RATKAGYWKA TGKDRKVVCQ STVTGYRKTL VFYRGRAPLG  60
DRTDWIMHEY RLSDDLAQGP SGHQGVFALC RVIKKNENAQ KTNDSHGEPK AKRVGSASNS  120
GEDLSSTRIS NEPLNISDDL SSRASYQHNE SHYSSHVTSP YEVNPMAEFD PTSRETNPAD  180
FWVSPDFILD SSKDYPQLQE AMPNYFPQYK SAMASWQSYE NTESPYSSYP NFTGDVTMAD  240
NANQVADMSP FSGHTGYMGY YGNEEMQFEG FDQPSSLRNP TSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-30210172171NO APICAL MERISTEM PROTEIN
1ut4_B9e-30210172171NO APICAL MERISTEM PROTEIN
1ut7_A9e-30210172171NO APICAL MERISTEM PROTEIN
1ut7_B9e-30210172171NO APICAL MERISTEM PROTEIN
3swm_A1e-29210175174NAC domain-containing protein 19
3swm_B1e-29210175174NAC domain-containing protein 19
3swm_C1e-29210175174NAC domain-containing protein 19
3swm_D1e-29210175174NAC domain-containing protein 19
3swp_A1e-29210175174NAC domain-containing protein 19
3swp_B1e-29210175174NAC domain-containing protein 19
3swp_C1e-29210175174NAC domain-containing protein 19
3swp_D1e-29210175174NAC domain-containing protein 19
4dul_A9e-30210172171NAC domain-containing protein 19
4dul_B9e-30210172171NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.85151e-142shoot
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in tissue reunion of wounded inflorescence stems. Required for the division of pith cells in the reunion process, which is dependent on polar-transported auxin and the wound-inducible hormones ethylene and jasmonate (PubMed:21911380). Binds to the promoters of XTH19 and XTH20 to induce their expression via auxin signaling. XTH19 and XTH20 are involved in cell proliferation in the tissue reunion process of incised stems (PubMed:25182467). Involved in hypocotyl graft union formation. Required for the auxin- mediated promotion of vascular tissue proliferation during hypocotyl graft attachment (PubMed:27986917). {ECO:0000269|PubMed:21911380, ECO:0000269|PubMed:25182467, ECO:0000269|PubMed:27986917}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00439DAPTransfer from AT4G17980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G040400.2.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by wounding in the flowering stem. {ECO:0000269|PubMed:21911380}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4309451e-42AM430945.2 Vitis vinifera contig VV78X241223.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020418962.10.0NAC domain-containing protein 86
SwissprotO496972e-59NAC71_ARATH; NAC domain-containing protein 71
TrEMBLA0A251P3I40.0A0A251P3I4_PRUPE; Uncharacterized protein
STRINGEMJ104980.0(Prunus persica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.16e-62NAC domain containing protein 71
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Asahina M,Satoh S
    Molecular and physiological mechanisms regulating tissue reunion in incised plant tissues.
    J. Plant Res., 2015. 128(3): p. 381-8
    [PMID:25736731]
  3. Matsuoka K, et al.
    Differential Cellular Control by Cotyledon-Derived Phytohormones Involved in Graft Reunion of Arabidopsis Hypocotyls.
    Plant Cell Physiol., 2016. 57(12): p. 2620-2631
    [PMID:27986917]