PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G023700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family G2-like
Protein Properties Length: 279aa    MW: 31343 Da    PI: 8.0073
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G023700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.2e-332882155
             G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                        kprlrWtp+LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Prupe.5G023700.1.p 28 KPRLRWTPDLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 82
                        79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-322582IPR009057Homeodomain-like
PROSITE profilePS5129412.5642585IPR017930Myb domain
SuperFamilySSF466892.33E-162884IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-242883IPR006447Myb domain, plants
PfamPF002492.8E-93081IPR001005SANT/Myb domain
PfamPF143792.3E-23132176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MERNYGGGCD GEGNCGYENG VMMTRDPKPR LRWTPDLHDR FVDAVTKLGG PDKATPKSVL  60
RLMGLKGLTL YHLKSHLQKY RLGQHARKQN SGEEHNRENN RDSYVHFSNH HSTGSSAKSS  120
RGGNAEQGTL PFSEALKCQI EVQNRLQEQL EVQKKLQMRI EAQGKYLQAI LEKAQKGLSL  180
DMKGPTTIEA TRAQLTDFNL ALSNFMENIN EEDRRGKSNG STFEIYEEGN TEEHKDAKLK  240
VERGSINFDL NTKGSFDYVG SNAGDFEPRC FRLLDTTL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-202885158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-202885158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-202885158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-202885158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G023700.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020418963.10.0myb family transcription factor PHL11
SwissprotC0SVS41e-82PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A251P4150.0A0A251P415_PRUPE; Uncharacterized protein
STRINGXP_008238120.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51013142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.14e-73G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]