PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G003600.1.p
Common NamePRUPE_ppa026999mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 764aa    MW: 87037.7 Da    PI: 6.2206
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G003600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR199.43.7e-3181168291
                FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                         fYn+YA+++GFs+r+s  ++s+r+g+i++r+ vCs+eg+r++  ++  +++r+r++tr+gCka+++vkk+++g+w v+kl++eHnHel+p
  Prupe.5G003600.1.p  81 FYNSYARRIGFSTRVSVYQRSRRDGSIICRQVVCSREGFRRDGGEN--RSKRQRTVTRVGCKAQMTVKKQSSGRWAVSKLVKEHNHELVP 168
                         9*****************************************9988..999*************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031015.0E-2881168IPR004330FAR1 DNA binding domain
PfamPF105515.1E-30289380IPR018289MULE transposase domain
PROSITE profilePS5096611.301569605IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-10575603IPR007527Zinc finger, SWIM-type
SMARTSM005751.1E-8580607IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 764 aa     Download sequence    Send to blast
MDFEPLNIEN EAVEFDMGGS GDDDATALDL EHPDDSYDIF DDDLVQSSNS TRSRDDLASG  60
DPNLEPYEGM EFDSEQASRI FYNSYARRIG FSTRVSVYQR SRRDGSIICR QVVCSREGFR  120
RDGGENRSKR QRTVTRVGCK AQMTVKKQSS GRWAVSKLVK EHNHELVPPD KVHCLRSHRH  180
VSGPARSLID TLQAAGMGPS GVMSVLIKES GGINNVGFTK VDCQNYMSSS RQRTLGSGGQ  240
FVFDYLKRMQ AEDPGFFFAV QGDFENLTGN IFWADSNSRM NYDYFGDTVT FDTTYRTNRY  300
RVPFAPFTGW NHHGQPVLFG CSLLLNESES SFVWLFQTWL AAMSTRHPVS ITTDQDRIIR  360
AAVGQVFPGT RHRFCKWNVL REAQEKLSDV YHSHPTFEAE FQRCINMTET IDEFESCWES  420
LLQRYDIGDN EWLQSMYDAR QQWVPVFLRD TFFGEMSVTQ GSDNINSYFD GYINASTNIQ  480
VLIKQYEKAI ATRHEKEVKA DYDTMNISPI LRTPSPMEKQ AAKLYTRVVF MKFQEELVET  540
LAYPATMVDD TGSETVYRVA KFGEDHKVYF VRFNVFEKKS SCSCQMFEFS GIICRHILAV  600
FRVTNVLTLP NHYILKRWTK NAKSGVVWDE HTLGLPNDSQ DSSAARYDNL RREAIKYVEE  660
GAESVRVYNV AMDALHEAAS EVTAAKKHGL GVVQSTSINC SQQLQSCTVD QDKKIKELAA  720
ELDIASQQCE AYRAKLLAIL KDMEEQKLKI SVNVRNVRLN LRS*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hypocotyls, rosette and cauline leaves, inflorescences stems, flowers and siliques. {ECO:0000269|PubMed:15591448}.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G003600.1.p
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007208906.10.0protein FAR1-RELATED SEQUENCE 5
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLM5WTJ30.0M5WTJ3_PRUPE; Uncharacterized protein
STRINGEMJ101050.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]