PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G003000.1.p
Common NamePRUPE_ppa008311mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bZIP
Protein Properties Length: 338aa    MW: 37269.1 Da    PI: 4.4536
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G003000.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.63.1e-09153194445
                         XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                         +k+ rr  +N+ AA rsR+RKk ++  Le k+k Le+e ++L
  Prupe.5G003000.1.p 153 SKKRRRQLRNKDAAVRSRERKKIYVRDLEMKSKYLEGECRRL 194
                         6999**********************************9866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.9E-10149209No hitNo description
SMARTSM003380.0033149214IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.37152194IPR004827Basic-leucine zipper domain
PfamPF077161.8E-7154194IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.13E-10154209No hitNo description
CDDcd147045.86E-15155206No hitNo description
PROSITE patternPS000360157172IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0016021Cellular Componentintegral component of membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MELEGDVGFL DENDIIGEID WDFLFDGSNT LEDVLELENP VVTATGSSSP SPSSTVEDAP  60
SDSSPDWIGE IETILMKDDD VNGNQVVPDS VEPTNAEYYE KFLADVLVDS PSTDAGSNAS  120
ADSEKEKLDR SPLNDDDDDD DDAADADADD PISKKRRRQL RNKDAAVRSR ERKKIYVRDL  180
EMKSKYLEGE CRRLGRLLQC CYAENHALRL GLQMNNAYGH GHGVLATKQE SAVLLLELLL  240
LGSLLRCLDI MCLVALPLIL MAGLRNPLNN VAANKDLENV DLRPRGAASK MFQHSVLLCF  300
SKSRRCKASR TKMKHSRFPC LLGSYVSFAL PLLMLAT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppe.45450.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G003000.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT3739721e-105KT373972.1 Pyrus pyrifolia cultivar mixueli putative bZIP transcription 60 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007209330.10.0bZIP transcription factor 60
TrEMBLM5W9Y40.0M5W9Y4_PRUPE; Uncharacterized protein
STRINGEMJ105290.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120093032
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G42990.14e-15basic region/leucine zipper motif 60