PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.5G002300.1.p
Common NamePRUPE_ppa000682mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family SBP
Protein Properties Length: 1071aa    MW: 118207 Da    PI: 8.0657
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.5G002300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.89.8e-41145222178
                         --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                         +Cqv++C++dls+ak+yhrrhkvCe+hska+++ v++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  Prupe.5G002300.1.p 145 MCQVDNCKEDLSNAKDYHRRHKVCEIHSKATKAPVAKQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 222
                         6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.8E-34140207IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.718143220IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.27E-37144224IPR004333Transcription factor, SBP-box
PfamPF031108.0E-30146219IPR004333Transcription factor, SBP-box
SuperFamilySSF484037.65E-5864961IPR020683Ankyrin repeat-containing domain
CDDcd002044.06E-4867960No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1071 aa     Download sequence    Send to blast
MEDVGGQVAA PIFIHQTLSG RFCDVPAMAR KRDLPYQGSN YQHPHSQQPR FTTAGNNWNP  60
NVWDWDNVRF VAKPLDAEML HLGSSRTEQG KKEEASGAVK NTAEDEDDES LQLNLAGGLT  120
SVEEPMPRPN KRVRSGSPGN GSYPMCQVDN CKEDLSNAKD YHRRHKVCEI HSKATKAPVA  180
KQMQRFCQQC SRFHPLSEFD EGKRSCRRRL AGHNRRRRKT QPEDVTSRLT LPGDGDTKSI  240
GNLDIVNLLA AIARPQGKND VRNINCSSVL DREQLLQILS KINSLPLPAD LAAKLPNLGS  300
LNRKAVELLA LDLQNKLNGR TSASTVDLLT VLSATLAASS PEALAMLSQK SSQSSDSEKT  360
KLTCSDQAAG PNLHKIPTQE FNSAGGERSS TSYQSPMEDS DCQVQETRVN LPLQLFSSSP  420
ENDSPPKLAS SRKYFSSDSS NPTEDRSPSS SPPVVQTLFP MKSMAETVKS EKLSISKEVN  480
ANPDSSRTRG CNMPFDLFRG SNRGADASSI QSFPHQAGYT SSGSDHSPSS LNSDPQDRTG  540
RILFKLFDKD PSHLPGSLRA QIYNWLSNSP SEMESYIRPG CVVLSVYVSM SSAAWEQFEG  600
NLGQRVSSLV QSSDSDFWRS GRFLVHTGRQ LASHKDGKIR ICKAWRSCSS PELISVSPLA  660
VVGGQETSLV LRGRNLTNLG TRIHCTYLGG YTSKEATGST YHGTMYDEIN LGSFQVHDAS  720
PGVLGRCFIE VENGFKGNGF PVIIADATIC RELRLLESVF DAEAKACDVI SEDENRDYGR  780
PTSREEVLHF LNELGWLFQR KRICSMLQEP RCSLSRFKFL LTFTVEKDCC VLVKTLLDIL  840
FERNLDGDGL SGESLGMLSD IQLLNRAVKR RCRKMVDLLV NYSVISSDKR YIFPPNLAGP  900
GGMTPLHLAA CMSNTDDMID ALTNDPQEIG LNCWNSLLDA NGQSPYAYSL MRNNYSYNKL  960
VARKLADRRN SQVTVTIGNE IEQPQMTMEL EHRTSTRFRQ GSGSCAKCAM AASKYRRRVP  1020
GAQGLLQRPF IHSMLAIAAV CVCVCLFLRG SPDIGLVAPF KWENLDFGTI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-31136219184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1865870RAVKRR
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in vasculature of aerial parts. Expressed in cotyledons and leaf petioles. {ECO:0000269|PubMed:15703061}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.5G002300.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020418884.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A251P2S50.0A0A251P2S5_PRUPE; Uncharacterized protein
STRINGXP_008237887.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]