PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G253600.1.p
Common NamePRUPE_ppa020620mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 386aa    MW: 44507 Da    PI: 6.8526
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G253600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM149.71.5e-46832082128
                 NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         ppG+rF+P deelvv+yLkkkv +++l+  + i ev++y+++P+ L  k  k +e ewyfF++rd+ky++g+r++ra+ sgyWkatg dk+
  Prupe.4G253600.1.p  83 PPGYRFNPLDEELVVHYLKKKVLDQPLPP-NRIIEVNLYRHNPEFLAeKYRKYGEAEWYFFTPRDRKYKNGSRPKRAAGSGYWKATGADKA 172
                         9*************************999.6799************9344455788*********************************** PP

                 NAM  92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v s +g+lvg +k Lvfy+g+ pkg kt+W+mhe+r+
  Prupe.4G253600.1.p 173 VRS-NGALVGFRKALVFYRGKPPKGDKTNWIMHEFRV 208
                         **9.99*****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.66E-5681235IPR003441NAC domain
PROSITE profilePS5100555.19282235IPR003441NAC domain
PfamPF023651.5E-2583208IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MEPVEQSHPH SKASVTSQVA SYSLINKQSH AQAHLTHDLT QPNEPGNSLI TSVSAGAELS  60
DDESNSFNNN LKNEEDEFFD SFPPGYRFNP LDEELVVHYL KKKVLDQPLP PNRIIEVNLY  120
RHNPEFLAEK YRKYGEAEWY FFTPRDRKYK NGSRPKRAAG SGYWKATGAD KAVRSNGALV  180
GFRKALVFYR GKPPKGDKTN WIMHEFRVKD SPVRRKRGEN DMRLDNWVLC RIYKKVDKNS  240
KRCETRNHVE DPLSPQPQII NGEGMEMEME MEMSTIFDPM VEYDNKYSIM QNVYGVSHNG  300
MVHSQLQAVR MNEVPSYPNI GHPQAIGARA SSMPLLPDSL LESRYIDEST IHPDDLYNLK  360
AFERSLYDTY QRQFPPVENF YPYLE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-558123516165NO APICAL MERISTEM PROTEIN
1ut4_B1e-558123516165NO APICAL MERISTEM PROTEIN
1ut7_A1e-558123516165NO APICAL MERISTEM PROTEIN
1ut7_B1e-558123516165NO APICAL MERISTEM PROTEIN
4dul_A1e-558123516165NAC domain-containing protein 19
4dul_B1e-558123516165NAC domain-containing protein 19
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapPrupe.4G253600.1.p
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214486.10.0NAC transcription factor 29
TrEMBLM5X9E70.0M5X9E7_PRUPE; Uncharacterized protein
STRINGEMJ156850.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101121642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.11e-63NAC domain containing protein 32