PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Prupe.4G243500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NF-YB
Protein Properties Length: 250aa    MW: 26762.9 Da    PI: 6.9488
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Prupe.4G243500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB159.64.8e-5060154195
               NF-YB   1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                         vreqd+++Pianv+rim+++lP +akis+daket+qecvse+i+f+t+ea+++c+re+rkt++++d+lwa+++lGf++yvepl+++l+k+r
  Prupe.4G243500.1.p  60 VREQDQYMPIANVIRIMRRILPPHAKISDDAKETIQECVSEYIAFITGEANERCRREQRKTVTAEDILWAMGKLGFDNYVEPLTLFLQKHR 150
                         69***************************************************************************************** PP

               NF-YB  92 eleg 95 
                         e e+
  Prupe.4G243500.1.p 151 ESEN 154
                         *987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.7E-4756159IPR009072Histone-fold
SuperFamilySSF471131.1E-3563159IPR009072Histone-fold
PfamPF008089.4E-2566130IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.1E-1694112No hitNo description
PRINTSPR006156.1E-16113131No hitNo description
PRINTSPR006156.1E-16132150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MRGPPSSRHA KSSSAQVNNS ERSNSKVPIN ATPAATNSNA AAAAANAGDP AQLAPQQSVV  60
REQDQYMPIA NVIRIMRRIL PPHAKISDDA KETIQECVSE YIAFITGEAN ERCRREQRKT  120
VTAEDILWAM GKLGFDNYVE PLTLFLQKHR ESENSDRSTL RAEFMKRDRA VDFGPAGPPI  180
ALMPPPPPPY GPGYPFGPQH GPGMFDPSML GMFRDGSSSG SGGGAGSSSA SGDQGQNSLE  240
GFDPFAQFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-4061151393NF-YB
4awl_B8e-4061151494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A8e-4061151494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007214722.11e-146hypothetical protein PRUPE_ppa026173mg, partial
SwissprotQ9SFD81e-65NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLM5WRR41e-146M5WRR4_PRUPE; Uncharacterized protein (Fragment)
STRINGAT1G21970.13e-63(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.19e-59NF-YB family protein